StarFunc result for job id P49335

User Input

>input (361 residues)
MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTS
LSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAP
NPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHC
QDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEGLQL
SFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKC
PKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHD
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y739	0.487	0.487	4.100E-44	361	0.997	0.997	A0A2R8Y739.pdb.gz	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
2	AFDB:Q2VUE0	0.458	0.627	4.790E-25	260	0.488	0.677	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
3	AFDB:Q9UKI9	0.394	0.329	1.659E-17	436	0.399	0.330	Q9UKI9.pdb.gz	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
4	AFDB:B7ZQA9	0.423	0.346	1.844E-17	445	0.377	0.306	B7ZQA9.pdb.gz	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
5	AFDB:Q9VK71	0.393	0.164	6.685E-15	893	0.377	0.152	Q9VK71.pdb.gz	PDM2B_DROME POU domain protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=pdm2 PE=2 SV=2
6	AFDB:A0A2R8RYW1	0.207	0.213	2.267E-14	350	0.307	0.317	A0A2R8RYW1.pdb.gz
7	AFDB:H0YKT2	0.368	0.220	7.686E-14	618	0.385	0.225	H0YKT2.pdb.gz	H0YKT2_HUMAN POU domain protein (Fragment) OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=2
8	AFDB:A0A1C7CYY7	0.372	0.241	3.267E-11	577	0.299	0.187	A0A1C7CYY7.pdb.gz	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
9	AFDB:Q9DAC9	0.239	0.261	4.737E-11	329	0.255	0.280	Q9DAC9.pdb.gz	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
10	PDB:6t90K	0.182	0.886	8.010E-7	73	0.144	0.712	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
11	AFDB:Q5MD19	0.242	0.199	2.001E-5	461	0.211	0.165	Q5MD19.pdb.gz
12	PDB:4egcA	0.135	0.101	1.641E-2	539	0.094	0.063	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:5iplF	0.109	0.132	1.887E-1	277	0.075	0.097	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
14	PDB:2hi3A	0.141	0.593	6.398E-1	73	0.047	0.233	2hi3A.pdb.gz
15	PDB:1oqyA	0.090	0.089	8.798E-1	363	0.119	0.118	1oqyA.pdb.gz
16	PDB:7aoaD	0.194	0.200	9.784E-1	343	0.091	0.096	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
17	PDB:6cf1B	0.126	0.423	1.032	94	0.022	0.085	6cf1B.pdb.gz
18	PDB:6dv9F	0.088	0.147	1.032	174	0.069	0.144	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:7f0rF	0.099	0.120	1.032	278	0.069	0.090	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
20	PDB:3g46A	0.090	0.158	1.088	146	0.069	0.171	3g46A.pdb.gz	Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y739	0.0	744	361	0.997	0.997	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
2	P49335	0.0	746	361	1.000	1.000	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
3	P62515	0.0	737	361	0.986	0.986	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
4	P62516	0.0	737	361	0.986	0.986	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
5	P79746	2.43e-137	397	378	0.643	0.614	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1
6	P20265	1.31e-127	375	443	0.673	0.549	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
7	P31360	2.81e-127	374	445	0.673	0.546	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
8	P56222	4.30e-124	366	445	0.676	0.548	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
9	P31361	1.71e-115	346	497	0.670	0.487	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2
10	Q63262	2.08e-115	346	497	0.670	0.487	PO3F3_RAT POU domain, class 3, transcription factor 3 OS=Rattus norvegicus OX=10116 GN=Pou3f3 PE=1 SV=2
11	Q2VUE0	4.39e-115	336	260	0.499	0.692	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
12	P20264	1.44e-114	343	500	0.668	0.482	PO3F3_HUMAN POU domain, class 3, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU3F3 PE=1 SV=2
13	O73861	7.25e-112	332	372	0.582	0.565	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
14	P16241	8.74e-99	301	427	0.471	0.398	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
15	Q03052	7.81e-98	299	451	0.388	0.310	PO3F1_HUMAN POU domain, class 3, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU3F1 PE=2 SV=3
16	P20267	1.12e-97	299	451	0.388	0.310	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
17	P21952	1.26e-97	298	449	0.388	0.312	PO3F1_MOUSE POU domain, class 3, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou3f1 PE=1 SV=1
18	P20268	3.58e-76	241	380	0.335	0.318	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
19	A7Y7W2	4.15e-70	226	389	0.296	0.275	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
20	Q7T103	4.47e-63	209	449	0.266	0.214	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	48	15.3	Homeobox KN domain
2	PF00046 Homeodomain	4.3e-15	66.6	Homeodomain
3	PF13560 HTH_31	1.6e+02	14.0	Helix-turn-helix domain
4	PF00157 Pou	6.3e-34	127.1	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362296

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361512	0.680	Ribose-phosphate pyrophosphokinase 1
2	9606.ENSP00000323588	0.653	Transcription factor SOX-2
3	9606.ENSP00000372295	0.647	Gap junction beta-2 protein
4	9606.ENSP00000362413	0.609	Phosphoglycerate kinase 1
5	9606.ENSP00000368808	0.605	Small muscular protein
6	9606.ENSP00000424595	0.605	Ribose-phosphate pyrophosphokinase 3
7	9606.ENSP00000255476	0.604	Regulatory factor X-associated protein
8	9606.ENSP00000265715	0.602	Pendrin
9	9606.ENSP00000404100	0.583	Paired box protein Pax-6
10	9606.ENSP00000295886	0.577	Homeobox protein Nkx-6.1
11	9606.ENSP00000305071	0.577	DNA-binding protein RFXANK
12	9606.ENSP00000331902	0.572	Collagen alpha-5(IV) chain
13	9606.ENSP00000283179	0.570	Heterogeneous nuclear ribonucleoprotein U
14	9606.ENSP00000357581	0.570	Homeobox protein Nkx-6.2
15	9606.ENSP00000401513	0.570	Stereocilin
16	9606.ENSP00000218249	0.568	Ras-related protein Rab-40A-like
17	9606.ENSP00000344285	0.565	Brain-specific homeobox protein homolog
18	9606.ENSP00000290524	0.563	DNA-binding protein RFX5
19	9606.ENSP00000306335	0.560	DNA-binding protein RFX2
20	9606.ENSP00000205890	0.557	Unconventional myosin-XV

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0000976	0.966	transcription cis-regulatory region binding
GO:0000981	0.906	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.846	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.720	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0032502	0.991	developmental process
GO:0065007	0.963	biological regulation
GO:0009987	0.960	cellular process
GO:0048856	0.950	anatomical structure development
GO:0007605	0.950	sensory perception of sound
GO:0050789	0.928	regulation of biological process
GO:0050794	0.922	regulation of cellular process
GO:0007275	0.813	multicellular organism development
GO:0019222	0.684	regulation of metabolic process
GO:0060255	0.672	regulation of macromolecule metabolic process
GO:0048731	0.657	system development
GO:0008152	0.652	metabolic process
GO:0044237	0.644	cellular metabolic process
GO:0071704	0.621	organic substance metabolic process
GO:0010468	0.587	regulation of gene expression
GO:0051171	0.567	regulation of nitrogen compound metabolic process
GO:0080090	0.558	regulation of primary metabolic process
GO:0019219	0.553	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.552	regulation of biosynthetic process
GO:0046483	0.546	heterocycle metabolic process
GO:0051252	0.541	regulation of RNA metabolic process
GO:0048518	0.515	positive regulation of biological process
GO:2001141	0.503	regulation of RNA biosynthetic process
GO:0009058	0.501	biosynthetic process
GO:0006355	0.493	regulation of DNA-templated transcription
GO:0048522	0.407	positive regulation of cellular process
GO:0006725	0.375	cellular aromatic compound metabolic process
GO:0048513	0.363	animal organ development
GO:0007399	0.362	nervous system development
GO:0051173	0.357	positive regulation of nitrogen compound metabolic process
GO:1901360	0.347	organic cyclic compound metabolic process
GO:0048869	0.345	cellular developmental process
GO:0030154	0.337	cell differentiation
GO:0010604	0.318	positive regulation of macromolecule metabolic process
GO:0044238	0.317	primary metabolic process
GO:0045893	0.300	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.986	nuclear lumen
GO:0005654	0.975	nucleoplasm
GO:0005737	0.366	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]