StarFunc result for job id P49336

User Input

>input (464 residues)
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49336	1.000	1.000	2.371E-86	464	1.000	1.000	P49336.pdb.gz	CDK8_HUMAN Cyclin-dependent kinase 8 OS=Homo sapiens OX=9606 GN=CDK8 PE=1 SV=1
2	AFDB:Q9BWU1	0.782	0.723	6.268E-73	502	0.838	0.775	Q9BWU1.pdb.gz	CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
3	AFDB:Q9VT57	0.771	0.788	4.564E-65	454	0.670	0.685	Q9VT57.pdb.gz	CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster OX=7227 GN=Cdk8 PE=1 SV=2
4	AFDB:F6QTA4	0.548	0.638	2.292E-43	398	0.625	0.729	F6QTA4.pdb.gz	F6QTA4_HUMAN Cyclin dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
5	PDB:7kpvA	0.666	0.855	6.122E-30	357	0.338	0.440	7kpvA.pdb.gz
6	AFDB:Q9LMT0	0.555	0.653	2.039E-26	391	0.293	0.348	Q9LMT0.pdb.gz	CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana OX=3702 GN=CDKD-3 PE=1 SV=1
7	PDB:4krcA	0.548	0.835	2.488E-24	297	0.233	0.364	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
8	AFDB:F4ICB6	0.582	0.388	4.579E-24	709	0.274	0.179	F4ICB6.pdb.gz	IBS1_ARATH Protein IMPAIRED IN BABA-INDUCED STERILITY 1 OS=Arabidopsis thaliana OX=3702 GN=IBS1 PE=3 SV=1
9	PDB:4yc3A	0.555	0.853	4.894E-24	295	0.259	0.407	4yc3A.pdb.gz
10	PDB:4eomC	0.509	0.834	3.523E-23	276	0.259	0.435	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
11	PDB:4gcjA	0.526	0.778	3.944E-23	304	0.265	0.405	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
12	PDB:3mi9A	0.549	0.760	4.173E-23	329	0.231	0.325	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
13	PDB:1unlA	0.549	0.852	1.364E-22	292	0.254	0.404	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:4ek6A	0.510	0.820	3.363E-22	279	0.248	0.412	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
15	AFDB:B9X2H6	0.542	0.241	1.442E-21	1080	0.263	0.113	B9X2H6.pdb.gz	B9X2H6_DANRE Cyclin dependent kinase like 5 long OS=Danio rerio OX=7955 GN=Cdkl5 PE=2 SV=1
16	PDB:6o9l8	0.547	0.824	2.162E-21	299	0.263	0.408	6o9l8.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
17	PDB:7opmA	0.561	0.710	1.951E-20	362	0.237	0.304	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
18	AFDB:Q9UQ07	0.529	0.583	1.048E-19	419	0.237	0.263	Q9UQ07.pdb.gz	MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens OX=9606 GN=MOK PE=2 SV=1
19	AFDB:A0A024R0I0	0.517	0.388	7.133E-19	629	0.224	0.165	A0A024R0I0.pdb.gz
20	AFDB:A1L1U2	0.505	0.327	1.254E-18	737	0.222	0.140	A1L1U2.pdb.gz	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZUQ1	0.0	642	457	0.733	0.744	A0A8I5ZUQ1_RAT Cyclin-dependent kinase 19 OS=Rattus norvegicus OX=10116 GN=Cdk19 PE=3 SV=1
2	A0A8I5ZVW8	0.0	842	416	0.890	0.993	A0A8I5ZVW8_RAT Cyclin-dependent kinase 8 OS=Rattus norvegicus OX=10116 GN=Cdk8 PE=3 SV=1
3	A0A8I5ZYM4	0.0	881	437	0.905	0.961	A0A8I5ZYM4_RAT Cyclin-dependent kinase 8 OS=Rattus norvegicus OX=10116 GN=Cdk8 PE=3 SV=1
4	D3ZDM6	0.0	754	501	0.828	0.766	D3ZDM6_RAT Cyclin-dependent kinase 19 OS=Rattus norvegicus OX=10116 GN=Cdk19 PE=4 SV=1
5	F6QTA4	0.0	517	398	0.619	0.721	F6QTA4_HUMAN Cyclin dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
6	P49336	0.0	975	464	1.000	1.000	CDK8_HUMAN Cyclin-dependent kinase 8 OS=Homo sapiens OX=9606 GN=CDK8 PE=1 SV=1
7	Q8R3L8	0.0	965	464	0.989	0.989	CDK8_MOUSE Cyclin-dependent kinase 8 OS=Mus musculus OX=10090 GN=Cdk8 PE=1 SV=3
8	Q9BWU1	0.0	746	502	0.830	0.767	CDK19_HUMAN Cyclin-dependent kinase 19 OS=Homo sapiens OX=9606 GN=CDK19 PE=1 SV=1
9	Q9VT57	0.0	667	454	0.679	0.694	CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster OX=7227 GN=Cdk8 PE=1 SV=2
10	Q95YH0	1.52e-101	310	380	0.358	0.437	CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum OX=44689 GN=cdk8 PE=2 SV=1
11	Q84TI6	3.12e-96	300	470	0.345	0.340	CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana OX=3702 GN=CDKE-1 PE=1 SV=2
12	O13958	4.01e-83	262	369	0.308	0.388	SSN3_SCHPO Serine/threonine-protein kinase srb10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srb10 PE=1 SV=2
13	P39073	1.78e-79	259	555	0.321	0.268	SSN3_YEAST Meiotic mRNA stability protein kinase SSN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSN3 PE=1 SV=3
14	Q9CAG1	2.61e-65	225	752	0.272	0.168	Q9CAG1_ARATH cyclin-dependent kinase OS=Arabidopsis thaliana OX=3702 GN=CDKG2 PE=1 SV=1
15	Q00526	1.05e-62	207	305	0.263	0.400	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
16	Q5PRD1	4.21e-62	218	800	0.256	0.149	Q5PRD1_DANRE Cell division protein kinase 11 OS=Danio rerio OX=7955 GN=zgc:101589 PE=1 SV=1
17	P34117	1.15e-61	204	292	0.261	0.414	CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum OX=44689 GN=cdk5 PE=2 SV=2
18	Q7T3L7	2.19e-61	204	302	0.267	0.411	Q7T3L7_DANRE Cell division control protein 2 OS=Danio rerio OX=7955 GN=cdc2 PE=1 SV=1
19	O55076	1.49e-60	201	298	0.269	0.419	CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus OX=10029 GN=CDK2 PE=1 SV=1
20	Q63699	1.88e-60	201	298	0.269	0.419	CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus OX=10116 GN=Cdk2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	6.4	18.1	Phosphotransferase enzyme family
2	PF06293 Kdo	32	15.4	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	5e-58	208.1	Protein kinase domain
4	PF17667 Pkinase_fungal	36	14.6	Fungal protein kinase
5	PF07714 PK_Tyr_Ser-Thr	1.1e-21	88.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008820556.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008837854.1	0.999	Cyclin C
2	1026970.XP_008853809.1	0.997	Mediator complex subunit 12
3	1026970.XP_008820340.1	0.995	Mediator of RNA polymerase II transcription subunit 23 isoform X1
4	1026970.XP_008840877.1	0.995	Mediator of RNA polymerase II transcription subunit 13 isoform X1
5	1026970.XP_008843515.1	0.995	Mediator of RNA polymerase II transcription subunit 1 isoform X1
6	1026970.XP_008821336.1	0.994	Mediator of RNA polymerase II transcription subunit 17 isoform X1
7	1026970.XP_008832792.1	0.994	Mediator of RNA polymerase II transcription subunit 10
8	1026970.XP_008821430.1	0.993	Mediator of RNA polymerase II transcription subunit 6 isoform X1
9	1026970.XP_008845600.1	0.993	Mediator of RNA polymerase II transcription subunit 7
10	1026970.XP_008846178.1	0.992	Mediator complex subunit 18
11	1026970.XP_008836187.1	0.991	Mediator of RNA polymerase II transcription subunit 30
12	1026970.XP_008845102.1	0.989	Mediator complex subunit 21
13	1026970.XP_008822590.1	0.988	Mediator of RNA polymerase II transcription subunit 4
14	1026970.XP_008827642.1	0.988	Mediator complex subunit 24
15	1026970.XP_008841178.1	0.988	Mediator complex subunit 14
16	1026970.XP_008845686.1	0.988	Mediator complex subunit 13 like
17	1026970.XP_008835478.1	0.985	Mediator of RNA polymerase II transcription subunit 16
18	1026970.XP_008853871.1	0.981	Mediator of RNA polymerase II transcription subunit 31
19	1026970.XP_008820210.1	0.980	Mediator of RNA polymerase II transcription subunit 9
20	1026970.XP_008822872.1	0.980	Mediator of RNA polymerase II transcription subunit 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.991	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0009987	0.987	cellular process
GO:0044238	0.987	primary metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0006807	0.958	nitrogen compound metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0048518	0.879	positive regulation of biological process
GO:1901564	0.879	organonitrogen compound metabolic process
GO:0019538	0.866	protein metabolic process
GO:0036211	0.858	protein modification process
GO:0080090	0.844	regulation of primary metabolic process
GO:0048522	0.803	positive regulation of cellular process
GO:0051171	0.792	regulation of nitrogen compound metabolic process
GO:0060255	0.786	regulation of macromolecule metabolic process
GO:0044237	0.704	cellular metabolic process
GO:0010468	0.685	regulation of gene expression
GO:0048519	0.674	negative regulation of biological process
GO:0019219	0.671	regulation of nucleobase-containing compound metabolic process
GO:0090207	0.636	regulation of triglyceride metabolic process
GO:0050896	0.629	response to stimulus
GO:0009892	0.572	negative regulation of metabolic process
GO:0051252	0.568	regulation of RNA metabolic process
GO:0009889	0.516	regulation of biosynthetic process
GO:0048523	0.511	negative regulation of cellular process
GO:0031326	0.484	regulation of cellular biosynthetic process
GO:0009893	0.475	positive regulation of metabolic process
GO:0051716	0.457	cellular response to stimulus
GO:0010604	0.356	positive regulation of macromolecule metabolic process
GO:0006355	0.350	regulation of DNA-templated transcription
GO:0051173	0.330	positive regulation of nitrogen compound metabolic process
GO:0031324	0.319	negative regulation of cellular metabolic process
GO:0048583	0.314	regulation of response to stimulus
GO:0031325	0.310	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005829	0.960	cytosol
GO:0140513	0.937	nuclear protein-containing complex
GO:1990234	0.907	transferase complex
GO:0043228	0.620	non-membrane-bounded organelle
GO:0043232	0.600	intracellular non-membrane-bounded organelle
GO:0016592	0.344	mediator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]