StarFunc result for job id P49354

User Input

>input (379 residues)
MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHSTENDSPTNVQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49354	1.000	1.000	5.978E-48	379	1.000	1.000	P49354.pdb.gz	FNTA_HUMAN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1
2	PDB:1d8dA	0.847	0.993	9.698E-38	323	0.807	0.947	1d8dA.pdb.gz	The basis for K-Ras4B binding specificity to protein farnesyltransferase revealed by 2 A resolution ternary complex structures.
3	AFDB:Q9VR31	0.795	0.907	3.289E-24	331	0.409	0.468	Q9VR31.pdb.gz	Q9VR31_DROME Farnesyl transferase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Fnta PE=1 SV=1
4	AFDB:O44501	0.763	0.879	5.663E-20	328	0.332	0.384	O44501.pdb.gz	O44501_CAEEL EOG090X08PK OS=Caenorhabditis elegans OX=6239 GN=fnta-1 PE=1 SV=1
5	AFDB:Q9LX33	0.735	0.849	6.667E-18	326	0.340	0.396	Q9LX33.pdb.gz	FNTA_ARATH Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=FTA PE=1 SV=2
6	AFDB:O60052	0.640	0.808	1.951E-15	294	0.253	0.327	O60052.pdb.gz	FNTA_SCHPO Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwp1 PE=1 SV=1
7	AFDB:Q9Y765	0.701	0.859	7.162E-15	306	0.235	0.291	Q9Y765.pdb.gz	FNTA_CANAX Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Candida albicans OX=5476 GN=RAM2 PE=1 SV=1
8	AFDB:P29703	0.683	0.813	1.365E-13	316	0.222	0.266	P29703.pdb.gz	FNTA_YEAST Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAM2 PE=1 SV=1
9	PDB:4ydoA	0.687	0.849	2.541E-13	303	0.232	0.290	4ydoA.pdb.gz	CRYSTAL STRUCTURE OF CANDIDA ALBICANS PROTEIN FARNESYLTRANSFERASE IN APO FORM
10	AFDB:Q00618	0.586	0.673	1.169E-8	327	0.161	0.187	Q00618.pdb.gz	PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BET4 PE=1 SV=3
11	AFDB:Q8VYB7	0.460	0.264	8.924E-7	678	0.132	0.074	Q8VYB7.pdb.gz	PGTA1_ARATH Geranylgeranyl transferase type-2 subunit alpha 1 OS=Arabidopsis thaliana OX=3702 GN=RGTA1 PE=1 SV=1
12	PDB:1dceA	0.454	0.310	3.765E-5	567	0.137	0.092	1dceA.pdb.gz	Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
13	PDB:7ntfA	0.242	0.126	1.267E-4	918	0.116	0.048	7ntfA.pdb.gz
14	AFDB:Q8BRH0	0.256	0.130	1.552E-4	920	0.148	0.061	Q8BRH0.pdb.gz	TMTC3_MOUSE Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
15	PDB:6bq1B	0.221	0.137	3.435E-4	728	0.127	0.066	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
16	PDB:6xt9D	0.248	0.240	4.455E-4	396	0.098	0.093	6xt9D.pdb.gz
17	PDB:5dseA	0.234	0.177	7.177E-4	537	0.127	0.089	5dseA.pdb.gz
18	PDB:7qe7J	0.255	0.206	1.636E-3	510	0.084	0.063	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:6c95A	0.249	0.147	2.416E-3	773	0.116	0.057	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
20	PDB:7qe7Y	0.249	0.201	2.523E-3	502	0.090	0.068	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49354	0.0	783	379	1.000	1.000	FNTA_HUMAN Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Homo sapiens OX=9606 GN=FNTA PE=1 SV=1
2	Q04631	0.0	631	377	0.923	0.928	FNTA_RAT Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Fnta PE=1 SV=1
3	Q541Z2	0.0	631	377	0.921	0.926	Q541Z2_MOUSE Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Mus musculus OX=10090 GN=Fnta PE=1 SV=1
4	Q61239	0.0	631	377	0.921	0.926	FNTA_MOUSE Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Mus musculus OX=10090 GN=Fnta PE=1 SV=1
5	Q9VR31	8.37e-107	318	331	0.409	0.468	Q9VR31_DROME Farnesyl transferase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=Fnta PE=1 SV=1
6	O44501	2.87e-72	230	328	0.325	0.375	O44501_CAEEL EOG090X08PK OS=Caenorhabditis elegans OX=6239 GN=fnta-1 PE=1 SV=1
7	Q9LX33	3.22e-70	225	326	0.343	0.399	FNTA_ARATH Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Arabidopsis thaliana OX=3702 GN=FTA PE=1 SV=2
8	O60052	3.50e-54	182	294	0.256	0.330	FNTA_SCHPO Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwp1 PE=1 SV=1
9	Q9Y765	6.28e-41	148	306	0.230	0.284	FNTA_CANAX Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Candida albicans OX=5476 GN=RAM2 PE=1 SV=1
10	P29703	6.07e-36	135	316	0.179	0.215	FNTA_YEAST Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAM2 PE=1 SV=1
11	Q8VYB7	3.40e-14	76.3	678	0.148	0.083	PGTA1_ARATH Geranylgeranyl transferase type-2 subunit alpha 1 OS=Arabidopsis thaliana OX=3702 GN=RGTA1 PE=1 SV=1
12	Q92696	5.89e-14	75.5	567	0.140	0.093	PGTA_HUMAN Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens OX=9606 GN=RABGGTA PE=1 SV=2
13	Q00618	7.17e-14	73.9	327	0.153	0.177	PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BET4 PE=1 SV=3
14	Q08602	1.31e-13	74.3	567	0.140	0.093	PGTA_RAT Geranylgeranyl transferase type-2 subunit alpha OS=Rattus norvegicus OX=10116 GN=Rabggta PE=1 SV=1
15	Q9JHK4	1.45e-13	74.3	567	0.148	0.099	PGTA_MOUSE Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus OX=10090 GN=Rabggta PE=1 SV=1
16	O94412	1.32e-12	70.5	344	0.169	0.186	PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bet4 PE=3 SV=1
17	Q9W501	2.00e-08	57.8	398	0.087	0.083	Q9W501_DROME LD45906p OS=Drosophila melanogaster OX=7227 GN=temp PE=1 SV=1
18	Q9VN77	3.93e-04	44.7	515	0.079	0.058	Q9VN77_DROME Geranylgeranyl transferase type-2 subunit alpha OS=Drosophila melanogaster OX=7227 GN=RabGGTa PE=1 SV=1
19	Q580J3	0.005	41.2	612	0.090	0.056	Q580J3_TRYB2 Protein farnesyltransferase alpha subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.830 PE=3 SV=1
20	Q0P4V8	0.49	35.0	832	0.071	0.032	Q0P4V8_XENTR Cell division cycle protein 27 homolog OS=Xenopus tropicalis OX=8364 GN=cdc27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01239 PPTA	4.9e-42	150.4	Protein prenyltransferase alpha subunit repeat
2	PF13428 TPR_14	35	16.6	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246166	0.999	Protein farnesyltransferase subunit beta
2	9606.ENSP00000404676	0.999	Geranylgeranyl transferase type-1 subunit beta
3	9606.ENSP00000447121	0.980	cDNA FLJ59570, highly similar to Protein farnesyltransferase subunit beta (EC 2.5.1.58)
4	9606.ENSP00000309163	0.978	CAAX prenyl protease 2
5	9606.ENSP00000361845	0.976	CAAX prenyl protease 1 homolog
6	9606.ENSP00000353104	0.968	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
7	9606.ENSP00000407586	0.953	GTPase HRas
8	9606.ENSP00000256078	0.949	GTPase KRas
9	9606.ENSP00000282841	0.946	Geranylgeranyl pyrophosphate synthase
10	9606.ENSP00000349078	0.933	Farnesyl pyrophosphate synthase
11	9606.ENSP00000358548	0.930	GTPase NRas
12	9606.ENSP00000357480	0.916	Dehydrodolichyl diphosphate synthase complex subunit NUS1
13	9606.ENSP00000317473	0.912	Geranylgeranyl transferase type-2 subunit beta
14	9606.ENSP00000365388	0.909	Decaprenyl-diphosphate synthase subunit 1
15	9606.ENSP00000358033	0.905	Decaprenyl-diphosphate synthase subunit 2
16	9606.ENSP00000248572	0.900	Guanine nucleotide-binding protein G(T) subunit gamma-T1
17	9606.ENSP00000311032	0.900	Caspase-3
18	9606.ENSP00000480828	0.870	Squalene synthase
19	9606.ENSP00000343552	0.836	Protein-S-isoprenylcysteine O-methyltransferase
20	9606.ENSP00000368965	0.742	Heparan-alpha-glucosaminide N-acetyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004661	1.000	protein geranylgeranyltransferase activity
GO:0004660	0.993	protein farnesyltransferase activity
GO:1901363	0.489	heterocyclic compound binding
GO:0008092	0.317	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0009987	0.989	cellular process
GO:0050789	0.979	regulation of biological process
GO:0043170	0.976	macromolecule metabolic process
GO:0050794	0.964	regulation of cellular process
GO:0044238	0.952	primary metabolic process
GO:0044237	0.937	cellular metabolic process
GO:0050896	0.895	response to stimulus
GO:0048518	0.884	positive regulation of biological process
GO:0019222	0.851	regulation of metabolic process
GO:0060255	0.812	regulation of macromolecule metabolic process
GO:0009893	0.770	positive regulation of metabolic process
GO:0006807	0.729	nitrogen compound metabolic process
GO:0080090	0.700	regulation of primary metabolic process
GO:0051171	0.699	regulation of nitrogen compound metabolic process
GO:0010604	0.663	positive regulation of macromolecule metabolic process
GO:1901564	0.616	organonitrogen compound metabolic process
GO:0019538	0.606	protein metabolic process
GO:0048522	0.561	positive regulation of cellular process
GO:0043412	0.544	macromolecule modification
GO:0051716	0.471	cellular response to stimulus
GO:0036211	0.445	protein modification process
GO:0051173	0.353	positive regulation of nitrogen compound metabolic process
GO:0031323	0.321	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990234	1.000	transferase complex
GO:0005737	1.000	cytoplasm
GO:0140535	0.999	intracellular protein-containing complex
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0005829	0.936	cytosol
GO:0005953	0.761	CAAX-protein geranylgeranyltransferase complex
GO:0043227	0.704	membrane-bounded organelle
GO:0043231	0.668	intracellular membrane-bounded organelle
GO:0005856	0.604	cytoskeleton
GO:0015630	0.487	microtubule cytoskeleton
GO:0016020	0.373	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.
RHEA:13345	0.993	(2E,6E)-farnesyl diphosphate + L-cysteinyl-[protein] = diphosphate + S-(2E,6E)-farnesyl-L-cysteinyl-[protein]
EC:2.5.1.58	0.993	protein farnesyltransferase.

[back to server]