StarFunc result for job id P49407

User Input

>input (418 residues)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C3PTE8	0.975	0.975	7.236E-77	418	0.907	0.907	C3PTE8.pdb.gz	C3PTE8_DANRE Arrestin, beta 1 OS=Danio rerio OX=7955 GN=arrb1 PE=2 SV=1
2	AFDB:A0A286YBG8	0.899	0.908	2.608E-68	414	0.754	0.761	A0A286YBG8.pdb.gz	A0A286YBG8_DANRE Arrestin, beta 2a OS=Danio rerio OX=7955 GN=fc14e09 PE=3 SV=1
3	AFDB:A5J090	0.906	0.928	1.376E-67	408	0.768	0.787	A5J090.pdb.gz	A5J090_XENLA Beta-arrestin 2 OS=Xenopus laevis OX=8355 PE=1 SV=1
4	AFDB:Q7T2D2	0.897	0.918	1.222E-66	408	0.751	0.770	Q7T2D2.pdb.gz	Q7T2D2_DANRE Arrb2b protein OS=Danio rerio OX=7955 GN=arrb2 PE=1 SV=1
5	AFDB:P32120	0.871	0.867	1.428E-66	420	0.766	0.762	P32120.pdb.gz	ARRB2_BOVIN Beta-arrestin-2 OS=Bos taurus OX=9913 GN=ARRB2 PE=1 SV=1
6	PDB:2wtrB	0.825	0.935	6.137E-59	367	0.856	0.975	2wtrB.pdb.gz
7	AFDB:P10523	0.876	0.904	6.015E-58	405	0.545	0.563	P10523.pdb.gz	ARRS_HUMAN S-arrestin OS=Homo sapiens OX=9606 GN=SAG PE=1 SV=3
8	AFDB:Q9V393	0.882	0.786	2.448E-57	470	0.615	0.547	Q9V393.pdb.gz	Q9V393_DROME Kurtz arrestin OS=Drosophila melanogaster OX=7227 GN=krz PE=1 SV=1
9	AFDB:P08168	0.887	0.917	1.049E-56	404	0.545	0.564	P08168.pdb.gz	ARRS_BOVIN S-arrestin OS=Bos taurus OX=9913 GN=SAG PE=1 SV=1
10	AFDB:P15887	0.864	0.895	6.819E-56	403	0.550	0.571	P15887.pdb.gz	ARRS_RAT S-arrestin OS=Rattus norvegicus OX=10116 GN=Sag PE=1 SV=1
11	AFDB:P36575	0.824	0.885	4.668E-55	388	0.545	0.588	P36575.pdb.gz	ARRC_HUMAN Arrestin-C OS=Homo sapiens OX=9606 GN=ARR3 PE=1 SV=2
12	PDB:5tv1A	0.765	0.941	1.609E-53	337	0.663	0.822	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
13	PDB:3gc3A	0.747	0.943	4.320E-53	329	0.778	0.988	3gc3A.pdb.gz
14	PDB:7jsmB	0.827	0.899	5.638E-50	383	0.536	0.585	7jsmB.pdb.gz
15	PDB:5w0pC	0.759	0.385	1.547E-47	850	0.517	0.254	5w0pC.pdb.gz
16	PDB:3gd1E	0.654	0.900	9.316E-42	300	0.675	0.940	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
17	PDB:5f0jB	0.428	0.553	1.733E-10	306	0.110	0.150	5f0jB.pdb.gz
18	PDB:2r51A	0.413	0.563	6.034E-10	288	0.120	0.174	2r51A.pdb.gz
19	PDB:6kzbC	0.167	0.113	5.117E-6	649	0.077	0.049	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
20	PDB:1f13A	0.178	0.115	5.981E-6	722	0.069	0.040	1f13A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YBG8	0.0	648	414	0.751	0.758	A0A286YBG8_DANRE Arrestin, beta 2a OS=Danio rerio OX=7955 GN=fc14e09 PE=3 SV=1
2	A5J090	0.0	652	408	0.756	0.775	A5J090_XENLA Beta-arrestin 2 OS=Xenopus laevis OX=8355 PE=1 SV=1
3	C3PTE8	0.0	791	418	0.907	0.907	C3PTE8_DANRE Arrestin, beta 1 OS=Danio rerio OX=7955 GN=arrb1 PE=2 SV=1
4	P17870	0.0	847	418	0.990	0.990	ARRB1_BOVIN Beta-arrestin-1 OS=Bos taurus OX=9913 GN=ARRB1 PE=1 SV=1
5	P29066	0.0	848	418	0.990	0.990	ARRB1_RAT Beta-arrestin-1 OS=Rattus norvegicus OX=10116 GN=Arrb1 PE=1 SV=1
6	P29067	0.0	627	410	0.749	0.763	ARRB2_RAT Beta-arrestin-2 OS=Rattus norvegicus OX=10116 GN=Arrb2 PE=1 SV=1
7	P32120	0.0	634	420	0.761	0.757	ARRB2_BOVIN Beta-arrestin-2 OS=Bos taurus OX=9913 GN=ARRB2 PE=1 SV=1
8	P32121	0.0	641	409	0.756	0.773	ARRB2_HUMAN Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2 PE=1 SV=2
9	P49407	0.0	855	418	1.000	1.000	ARRB1_HUMAN Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 PE=1 SV=2
10	Q6PFK2	0.0	631	406	0.739	0.761	Q6PFK2_DANRE Arrb2a protein OS=Danio rerio OX=7955 GN=zgc:66353 PE=2 SV=1
11	Q7T2D2	0.0	656	408	0.751	0.770	Q7T2D2_DANRE Arrb2b protein OS=Danio rerio OX=7955 GN=arrb2 PE=1 SV=1
12	Q8BWG8	0.0	842	418	0.986	0.986	ARRB1_MOUSE Beta-arrestin-1 OS=Mus musculus OX=10090 GN=Arrb1 PE=1 SV=1
13	Q91YI4	0.0	628	410	0.749	0.763	ARRB2_MOUSE Beta-arrestin-2 OS=Mus musculus OX=10090 GN=Arrb2 PE=1 SV=1
14	Q9V393	1.53e-172	493	470	0.617	0.549	Q9V393_DROME Kurtz arrestin OS=Drosophila melanogaster OX=7227 GN=krz PE=1 SV=1
15	P36575	2.89e-168	478	388	0.548	0.590	ARRC_HUMAN Arrestin-C OS=Homo sapiens OX=9606 GN=ARR3 PE=1 SV=2
16	Q9EQP6	2.02e-164	468	381	0.543	0.596	ARRC_MOUSE Arrestin-C OS=Mus musculus OX=10090 GN=Arr3 PE=1 SV=1
17	P08168	2.47e-160	459	404	0.545	0.564	ARRS_BOVIN S-arrestin OS=Bos taurus OX=9913 GN=SAG PE=1 SV=1
18	P10523	4.05e-155	446	405	0.555	0.573	ARRS_HUMAN S-arrestin OS=Homo sapiens OX=9606 GN=SAG PE=1 SV=3
19	P20443	1.05e-154	445	403	0.553	0.573	ARRS_MOUSE S-arrestin OS=Mus musculus OX=10090 GN=Sag PE=1 SV=1
20	P51485	1.00e-148	431	435	0.557	0.536	ARRB_CAEEL Beta-arrestin arr-1 OS=Caenorhabditis elegans OX=6239 GN=arr-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14796 AP3B1_C	3.3e+02	12.9	Clathrin-adaptor complex-3 beta-1 subunit C-terminal
2	PF02752 Arrestin_C	2e-23	94.8	Arrestin (or S-antigen), C-terminal domain
3	PF00339 Arrestin_N	2.2e-40	149.5	Arrestin (or S-antigen), N-terminal domain
4	PF13002 LDB19	3.5e+02	12.3	Arrestin_N terminal like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362680	0.999	Proto-oncogene tyrosine-protein kinase Src
2	9606.ENSP00000305372	0.998	Beta-2 adrenergic receptor
3	9606.ENSP00000296271	0.997	Rhodopsin
4	9606.ENSP00000479606	0.996	Clathrin heavy chain 1
5	9606.ENSP00000482835	0.994	AP-2 complex subunit beta
6	9606.ENSP00000258149	0.991	E3 ubiquitin-protein ligase Mdm2
7	9606.ENSP00000302486	0.991	Dual specificity mitogen-activated protein kinase kinase 1
8	9606.ENSP00000480499	0.991	E3 ubiquitin-protein ligase Itchy homolog
9	9606.ENSP00000351805	0.990	Vasopressin V2 receptor
10	9606.ENSP00000366746	0.989	Signal transducing adapter molecule 1
11	9606.ENSP00000292303	0.988	C-C chemokine receptor type 5
12	9606.ENSP00000310305	0.987	P2Y purinoceptor 2
13	9606.ENSP00000319635	0.986	C-X-C chemokine receptor type 2
14	9606.ENSP00000386884	0.986	C-X-C chemokine receptor type 4
15	9606.ENSP00000216797	0.985	NF-kappa-B inhibitor alpha
16	9606.ENSP00000312262	0.983	Beta-adrenergic receptor kinase 1
17	9606.ENSP00000362353	0.983	Glucagon-like peptide 1 receptor
18	9606.ENSP00000298316	0.982	ADP-ribosylation factor 6
19	9606.ENSP00000215832	0.981	Mitogen-activated protein kinase 1
20	9606.ENSP00000263025	0.979	Mitogen-activated protein kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.841	enzyme binding
GO:0005102	0.696	signaling receptor binding
GO:0060090	0.651	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.980	cellular process
GO:0048523	0.976	negative regulation of cellular process
GO:0008277	0.976	regulation of G protein-coupled receptor signaling pathway
GO:0023057	0.954	negative regulation of signaling
GO:0010648	0.954	negative regulation of cell communication
GO:0048585	0.952	negative regulation of response to stimulus
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0065009	0.941	regulation of molecular function
GO:0031401	0.913	positive regulation of protein modification process
GO:0050896	0.911	response to stimulus
GO:0009968	0.893	negative regulation of signal transduction
GO:0023052	0.859	signaling
GO:0007154	0.857	cell communication
GO:0051716	0.852	cellular response to stimulus
GO:1902533	0.831	positive regulation of intracellular signal transduction
GO:0007165	0.826	signal transduction
GO:0031323	0.812	regulation of cellular metabolic process
GO:0043408	0.807	regulation of MAPK cascade
GO:0051179	0.801	localization
GO:0008593	0.765	regulation of Notch signaling pathway
GO:0045746	0.735	negative regulation of Notch signaling pathway
GO:0051234	0.731	establishment of localization
GO:0016192	0.698	vesicle-mediated transport
GO:0006898	0.662	receptor-mediated endocytosis
GO:0031623	0.569	receptor internalization
GO:0045744	0.547	negative regulation of G protein-coupled receptor signaling pathway
GO:0032501	0.537	multicellular organismal process
GO:0008152	0.532	metabolic process
GO:0023058	0.507	adaptation of signaling pathway
GO:0071704	0.425	organic substance metabolic process
GO:0032879	0.414	regulation of localization
GO:0044238	0.412	primary metabolic process
GO:0044237	0.411	cellular metabolic process
GO:0043410	0.375	positive regulation of MAPK cascade
GO:0051174	0.360	regulation of phosphorus metabolic process
GO:0032502	0.347	developmental process
GO:0007186	0.344	G protein-coupled receptor signaling pathway
GO:0070372	0.334	regulation of ERK1 and ERK2 cascade
GO:0070374	0.316	positive regulation of ERK1 and ERK2 cascade
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0051049	0.310	regulation of transport
GO:0006807	0.307	nitrogen compound metabolic process
GO:0010468	0.302	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0043233	0.988	organelle lumen
GO:0005634	0.980	nucleus
GO:0070013	0.975	intracellular organelle lumen
GO:0032991	0.974	protein-containing complex
GO:0012505	0.972	endomembrane system
GO:0031410	0.946	cytoplasmic vesicle
GO:0031981	0.912	nuclear lumen
GO:0005654	0.762	nucleoplasm
GO:0042995	0.733	cell projection
GO:0098590	0.645	plasma membrane region
GO:0031090	0.645	organelle membrane
GO:0120025	0.635	plasma membrane bounded cell projection
GO:0030054	0.426	cell junction
GO:0005576	0.365	extracellular region
GO:0098588	0.356	bounding membrane of organelle
GO:0043230	0.351	extracellular organelle
GO:0005615	0.309	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]