StarFunc result for job id P49411

User Input

>input (452 residues)
MAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLL
DAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIR
TVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQ
RFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384ME17	0.923	0.917	1.837E-92	455	1.000	0.993	A0A384ME17.pdb.gz	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
2	AFDB:A1Z9E3	0.900	0.833	3.855E-75	489	0.619	0.573	A1Z9E3.pdb.gz	A1Z9E3_DROME Elongation factor Tu OS=Drosophila melanogaster OX=7227 GN=mEFTu1 PE=1 SV=1
3	AFDB:Q9Y700	0.861	0.886	4.466E-69	439	0.535	0.551	Q9Y700.pdb.gz	EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tuf1 PE=3 SV=1
4	AFDB:P02992	0.872	0.902	7.475E-69	437	0.555	0.574	P02992.pdb.gz	EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUF1 PE=1 SV=1
5	AFDB:Q9ZT91	0.879	0.876	1.867E-68	454	0.502	0.500	Q9ZT91.pdb.gz	EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
6	PDB:7a5gZ	0.843	0.965	1.907E-68	394	0.872	1.000	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
7	AFDB:Q9FUZ6	0.870	0.870	1.552E-67	452	0.522	0.522	Q9FUZ6.pdb.gz	Q9FUZ6_MAIZE Elongation factor Tu OS=Zea mays OX=4577 PE=3 SV=1
8	AFDB:C2E605	0.863	0.984	2.254E-65	396	0.500	0.571	C2E605.pdb.gz	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
9	AFDB:P23568	0.862	0.988	3.000E-65	394	0.480	0.551	P23568.pdb.gz	EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=tuf PE=1 SV=2
10	AFDB:P33166	0.856	0.976	2.100E-64	396	0.496	0.566	P33166.pdb.gz	EFTU_BACSU Elongation factor Tu OS=Bacillus subtilis (strain 168) OX=224308 GN=tuf PE=1 SV=1
11	PDB:1xb2A	0.431	0.522	3.200E-64	369	0.777	0.951	1xb2A.pdb.gz
12	AFDB:P17745	0.868	0.825	4.678E-64	476	0.487	0.462	P17745.pdb.gz	EFTU_ARATH Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
13	PDB:1ob2A	0.836	0.957	1.841E-57	393	0.491	0.565	1ob2A.pdb.gz	Kirromycin Defines a Specific Domain Arrangement of Elongation Factor EF-TU
14	PDB:7paj9	0.831	0.952	3.371E-51	393	0.480	0.552	7paj9.pdb.gz	Visualizing translation dynamics at atomic detail inside a bacterial cell.
15	PDB:3avtA	0.423	0.183	1.748E-49	1203	0.456	0.171	3avtA.pdb.gz	Molecular basis for RNA polymerization by Q beta replicase
16	PDB:6ji2A	0.752	0.785	2.058E-40	432	0.312	0.326	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
17	PDB:5o8wA	0.577	0.581	1.025E-35	449	0.290	0.292	5o8wA.pdb.gz	Protein glutaminylation is a yeast-specific posttranslational modification of elongation factor 1A.
18	PDB:5lzwjj	0.728	0.772	2.870E-35	425	0.261	0.278	5lzwjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
19	PDB:5lztjj	0.723	0.761	4.675E-33	428	0.241	0.255	5lztjj.pdb.gz	Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
20	PDB:6ra9B	0.391	0.386	1.168E-32	458	0.296	0.293	6ra9B.pdb.gz	Structural Cues for Understanding eEF1A2 Moonlighting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384ME17	0.0	921	455	1.000	0.993	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
2	A1Z9E3	0.0	575	489	0.619	0.573	A1Z9E3_DROME Elongation factor Tu OS=Drosophila melanogaster OX=7227 GN=mEFTu1 PE=1 SV=1
3	P02992	0.0	516	437	0.542	0.561	EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUF1 PE=1 SV=1
4	P49410	0.0	870	452	0.945	0.945	EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus OX=9913 GN=TUFM PE=1 SV=1
5	P49411	0.0	921	455	1.000	0.993	EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=3
6	P85834	0.0	866	452	0.938	0.938	EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1
7	Q8BFR5	0.0	865	452	0.936	0.936	EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1
8	Q9Y700	4.89e-177	504	439	0.540	0.556	EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tuf1 PE=3 SV=1
9	C2E605	4.61e-168	480	396	0.500	0.571	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
10	Q74JU6	4.61e-168	480	396	0.500	0.571	EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=tuf PE=3 SV=1
11	P23568	1.92e-156	450	394	0.482	0.553	EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) OX=272634 GN=tuf PE=1 SV=2
12	Q9ZT91	6.23e-156	451	454	0.496	0.493	EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=TUFA PE=1 SV=1
13	P0CE48	1.88e-155	447	394	0.491	0.563	EFTU2_ECOLI Elongation factor Tu 2 OS=Escherichia coli (strain K12) OX=83333 GN=tufB PE=1 SV=1
14	P0CE47	3.39e-155	447	394	0.491	0.563	EFTU1_ECOLI Elongation factor Tu 1 OS=Escherichia coli (strain K12) OX=83333 GN=tufA PE=1 SV=1
15	P33166	5.43e-155	446	396	0.498	0.568	EFTU_BACSU Elongation factor Tu OS=Bacillus subtilis (strain 168) OX=224308 GN=tuf PE=1 SV=1
16	Q9FUZ6	2.05e-154	447	452	0.500	0.500	Q9FUZ6_MAIZE Elongation factor Tu OS=Zea mays OX=4577 PE=3 SV=1
17	Q7K3V6	4.36e-153	444	456	0.460	0.456	Q7K3V6_DROME Elongation factor Tu, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFTu2 PE=1 SV=1
18	P74227	3.34e-149	432	399	0.487	0.551	EFTU_SYNY3 Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=tuf PE=1 SV=1
19	P9WNN1	7.09e-147	426	396	0.493	0.563	EFTU_MYCTU Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tuf PE=1 SV=1
20	Q54HB2	2.57e-145	423	424	0.456	0.486	EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=tufm PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19993 DO-GTPase2	4.8e+02	11.9	Double-GTPase 2
2	PF00009 GTP_EFTU	7.7e-50	180.7	Elongation factor Tu GTP binding domain
3	PF03144 GTP_EFTU_D2	2.4e-11	55.2	Elongation factor Tu domain 2
4	PF03143 GTP_EFTU_D3	1.2e-25	101.3	Elongation factor Tu C-terminal domain
5	PF01926 MMR_HSR1	13	17.4	50S ribosome-binding GTPase
6	PF03193 RsgA_GTPase	4.3e+02	12.2	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322439

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313877	0.999	Elongation factor Ts, mitochondrial
2	9606.ENSP00000373404	0.990	Mitochondrial ribosomal protein L2
3	9606.ENSP00000358072	0.989	Autophagy protein 5
4	9606.ENSP00000387334	0.987	NLR family member X1
5	9606.ENSP00000419038	0.981	Elongation factor G, mitochondrial
6	9606.ENSP00000245539	0.980	Mitochondrial ribosomal protein S7
7	9606.ENSP00000363676	0.969	60S ribosomal protein L11
8	9606.ENSP00000362036	0.967	Mitochondrial ribosomal protein S16
9	9606.ENSP00000272418	0.963	Belongs to the universal ribosomal protein uS5 family.
10	9606.ENSP00000278572	0.961	40S ribosomal protein S3
11	9606.ENSP00000288937	0.957	Mitochondrial ribosomal protein L17
12	9606.ENSP00000270625	0.954	Ribosomal protein S11
13	9606.ENSP00000253099	0.949	Mitochondrial ribosomal protein L4
14	9606.ENSP00000429374	0.944	Ribosomal protein S20
15	9606.ENSP00000053468	0.939	Mitochondrial ribosomal protein S10
16	9606.ENSP00000400467	0.939	L ribosomal proteins
17	9606.ENSP00000420311	0.937	Ribosomal protein L23
18	9606.ENSP00000472985	0.937	Ribosomal protein S5
19	9606.ENSP00000341885	0.936	Ribosomal protein S2
20	9606.ENSP00000262584	0.931	60S ribosomal protein L8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003746	0.999	translation elongation factor activity
GO:0003723	0.951	RNA binding
GO:0003824	0.443	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0006412	0.989	translation
GO:0006414	0.728	translational elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.949	intracellular organelle lumen
GO:0016020	0.893	membrane
GO:0005759	0.690	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]