StarFunc result for job id P49427

User Input

>input (236 residues)
MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA
RLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV
RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDG
VKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1Z1	0.836	0.836	3.948E-42	236	1.000	1.000	A0A024R1Z1.pdb.gz
2	AFDB:Q712K3	0.833	0.826	1.706E-40	238	0.801	0.794	Q712K3.pdb.gz	UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1
3	AFDB:P62253	0.673	0.925	2.935E-22	170	0.347	0.482	P62253.pdb.gz	UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens OX=9606 GN=UBE2G1 PE=1 SV=3
4	AFDB:Q42541	0.667	0.937	3.394E-21	166	0.335	0.476	Q42541.pdb.gz	UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana OX=3702 GN=UBC13 PE=2 SV=1
5	AFDB:Q9N9Z5	0.690	0.812	2.867E-20	200	0.326	0.385	Q9N9Z5.pdb.gz	Q9N9Z5_DROME Ubiquitin conjugating enzyme OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=2 SV=1
6	AFDB:P60604	0.658	0.934	3.251E-20	165	0.335	0.479	P60604.pdb.gz	UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1
7	AFDB:F4IWU7	0.637	0.745	9.448E-20	201	0.339	0.398	F4IWU7.pdb.gz	F4IWU7_ARATH Ubiquitin-conjugating enzyme 14 OS=Arabidopsis thaliana OX=3702 GN=UBC14 PE=1 SV=1
8	AFDB:P14682	0.722	0.583	5.144E-19	295	0.335	0.268	P14682.pdb.gz	UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC34 PE=1 SV=1
9	AFDB:O00102	0.646	0.911	6.210E-19	166	0.314	0.446	O00102.pdb.gz	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2
10	AFDB:Q02159	0.667	0.945	1.495E-18	165	0.305	0.436	Q02159.pdb.gz	UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC7 PE=1 SV=1
11	PDB:6d68A	0.608	0.889	4.770E-18	159	0.331	0.491	6d68A.pdb.gz
12	PDB:2cyxA	0.648	0.895	7.401E-18	169	0.326	0.456	2cyxA.pdb.gz
13	PDB:6op8A	0.629	0.874	1.506E-16	167	0.318	0.449	6op8A.pdb.gz
14	PDB:2aakA	0.614	0.956	5.989E-16	150	0.250	0.393	2aakA.pdb.gz
15	PDB:6cyrA	0.613	0.931	7.230E-16	153	0.254	0.392	6cyrA.pdb.gz
16	PDB:2uczA	0.631	0.893	1.635E-15	164	0.305	0.439	2uczA.pdb.gz
17	PDB:6zhuF	0.628	0.821	8.902E-15	178	0.284	0.376	6zhuF.pdb.gz	ATP induced conformational changes facilitate E1-E2 disulfide bridging in the ubiquitin system
18	PDB:4m1nC	0.591	0.855	1.218E-14	160	0.212	0.312	4m1nC.pdb.gz
19	PDB:3rczB	0.592	0.889	1.471E-14	155	0.242	0.368	3rczB.pdb.gz
20	PDB:2pe6A	0.580	0.838	1.668E-14	161	0.242	0.354	2pe6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49427	4.17e-176	484	236	1.000	1.000	UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens OX=9606 GN=CDC34 PE=1 SV=2
2	D4A453	4.08e-173	477	235	0.992	0.996	D4A453_RAT Cell division cycle 34, ubiqiutin conjugating enzyme OS=Rattus norvegicus OX=10116 GN=Cdc34 PE=3 SV=2
3	Q8CFI2	4.08e-173	477	235	0.992	0.996	UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus OX=10090 GN=Cdc34 PE=1 SV=1
4	Q712K3	1.28e-130	370	238	0.729	0.723	UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens OX=9606 GN=UBE2R2 PE=1 SV=1
5	A0A8I6AJQ8	2.57e-129	364	190	0.801	0.995	A0A8I6AJQ8_RAT Cell division cycle 34, ubiqiutin conjugating enzyme OS=Rattus norvegicus OX=10116 GN=Cdc34 PE=3 SV=1
6	P62253	5.83e-53	170	170	0.360	0.500	UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens OX=9606 GN=UBE2G1 PE=1 SV=3
7	P62254	5.83e-53	170	170	0.360	0.500	UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus OX=10090 GN=Ube2g1 PE=1 SV=3
8	P62255	5.83e-53	170	170	0.360	0.500	UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus OX=10116 GN=Ube2g1 PE=2 SV=3
9	Q42541	5.23e-49	160	166	0.314	0.446	UBC13_ARATH Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana OX=3702 GN=UBC13 PE=2 SV=1
10	Q9VXE8	2.72e-47	155	167	0.335	0.473	Q9VXE8_DROME RE34144p OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=1 SV=1
11	Q9N9Z5	1.09e-45	152	200	0.314	0.370	Q9N9Z5_DROME Ubiquitin conjugating enzyme OS=Drosophila melanogaster OX=7227 GN=Ubc7 PE=2 SV=1
12	P60604	7.94e-45	149	165	0.339	0.485	UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1
13	P60605	7.94e-45	149	165	0.339	0.485	UB2G2_MOUSE Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus OX=10090 GN=Ube2g2 PE=1 SV=1
14	F4IWU7	2.11e-43	147	201	0.314	0.368	F4IWU7_ARATH Ubiquitin-conjugating enzyme 14 OS=Arabidopsis thaliana OX=3702 GN=UBC14 PE=1 SV=1
15	Q02159	8.14e-42	142	165	0.297	0.424	UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC7 PE=1 SV=1
16	P14682	1.25e-41	145	295	0.335	0.268	UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC34 PE=1 SV=1
17	O00102	1.75e-41	141	166	0.309	0.440	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2
18	Q382B7	3.94e-35	127	247	0.305	0.291	Q382B7_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5790 PE=3 SV=1
19	P52478	1.30e-29	111	192	0.258	0.318	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
20	P25865	3.61e-29	108	152	0.267	0.414	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00179 UQ_con	7.7e-40	147.2	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000003201

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000003465	0.991	Ring-box 1, E3 ubiquitin protein ligase
2	9593.ENSGGOP00000013945	0.976	Cullin 1
3	9593.ENSGGOP00000026487	0.954	F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
4	9593.ENSGGOP00000007393	0.947	Ubiquitin-like modifier activating enzyme 1
5	9593.ENSGGOP00000001286	0.942	[Ubiquitin]: Exists either covalently attached to another protein, or free (unanchored). When covalently bound, it is conjugated to target proteins via an isopeptide bond either as a monomer (monoubiquitin), a polymer linked via different Lys residues of the ubiquitin (polyubiquitin chains) or a linear polymer linked via the initiator Met of the ubiquitin (linear polyubiquitin chains). Polyubiquitin chains, when attached to a target protein, have different functions depending on the Lys residue of the ubiquitin that is linked: Lys-6-linked may be involved in DNA repair
6	9593.ENSGGOP00000026578	0.942	Uncharacterized protein
7	9593.ENSGGOP00000004922	0.938	Beta-transducin repeat containing E3 ubiquitin protein ligase
8	9593.ENSGGOP00000021168	0.923	Uncharacterized protein
9	9593.ENSGGOP00000024001	0.923	Uncharacterized protein
10	9593.ENSGGOP00000012975	0.912	Ubiquitin-conjugating enzyme E2R 2
11	9593.ENSGGOP00000014395	0.910	Ubiquitin-like modifier activating enzyme 6
12	9593.ENSGGOP00000011923	0.858	Ubiquitin-like modifier activating enzyme 7
13	9593.ENSGGOP00000000864	0.832	Polyubiquitin-B
14	9593.ENSGGOP00000001803	0.823	Ring finger protein 7
15	9593.ENSGGOP00000023589	0.810	S-phase kinase-associated protein 2, E3 ubiquitin protein ligase
16	9593.ENSGGOP00000003886	0.808	Ubiquitin-like modifier activating enzyme 3
17	9593.ENSGGOP00000014750	0.806	TMEM189-UBE2V1 readthrough
18	9593.ENSGGOP00000001432	0.793	Belongs to the cullin family.
19	9593.ENSGGOP00000007292	0.793	Cullin 3
20	9593.ENSGGOP00000021839	0.782	Ubiquitin-conjugating enzyme E2 variant 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061631	1.000	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0019538	0.977	protein metabolic process
GO:0050896	0.968	response to stimulus
GO:0036211	0.917	protein modification process
GO:0032446	0.911	protein modification by small protein conjugation
GO:0044237	0.887	cellular metabolic process
GO:0016567	0.759	protein ubiquitination
GO:0048518	0.733	positive regulation of biological process
GO:0048522	0.681	positive regulation of cellular process
GO:0044087	0.676	regulation of cellular component biogenesis
GO:0044260	0.650	cellular macromolecule metabolic process
GO:0043632	0.631	modification-dependent macromolecule catabolic process
GO:0019941	0.621	modification-dependent protein catabolic process
GO:0006511	0.614	ubiquitin-dependent protein catabolic process
GO:0000209	0.504	protein polyubiquitination
GO:0048583	0.463	regulation of response to stimulus
GO:0048519	0.458	negative regulation of biological process
GO:0048523	0.453	negative regulation of cellular process
GO:0051716	0.448	cellular response to stimulus
GO:0019222	0.355	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016604	0.686	nuclear body
GO:0016607	0.674	nuclear speck
GO:0032991	0.348	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	1.000	E2 ubiquitin-conjugating enzyme.

[back to server]