StarFunc result for job id P49448

User Input

>input (558 residues)
MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADR
EDDPNFFKMVEGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTENELEKITRRFTMELAKKGFIGPGVDVPAPDMNTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFR
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGK
HGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYV
NAIEKVFKVYSEAGVTFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK14	0.921	0.921	1.587E-96	558	1.000	1.000	A0A140VK14.pdb.gz	A0A140VK14_HUMAN glutamate dehydrogenase [NAD(P)(+)] OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q8JHY1	0.893	0.916	8.026E-87	544	0.814	0.835	Q8JHY1.pdb.gz	Q8JHY1_ONCMY glutamate dehydrogenase [NAD(P)(+)] OS=Oncorhynchus mykiss OX=8022 GN=GDH01 PE=2 SV=1
3	AFDB:Q8JG17	0.894	0.925	6.203E-85	539	0.780	0.807	Q8JG17.pdb.gz	Q8JG17_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh1 PE=2 SV=1
4	PDB:6dhdA	0.894	0.996	1.179E-84	501	0.864	0.962	6dhdA.pdb.gz	Structures of bovine glutamate dehydrogenase complexes elucidate the mechanism of purine regulation.
5	AFDB:P54385	0.838	0.832	5.152E-71	562	0.652	0.648	P54385.pdb.gz	DHE3_DROME Glutamate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Gdh PE=1 SV=2
6	AFDB:Q9VCN3	0.837	0.872	1.063E-56	535	0.423	0.441	Q9VCN3.pdb.gz	Q9VCN3_DROME Glutamate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=bb8 PE=1 SV=2
7	AFDB:Q54KB7	0.799	0.885	2.569E-55	502	0.450	0.500	Q54KB7.pdb.gz	DHE3_DICDI Glutamate dehydrogenase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=gluD PE=1 SV=1
8	AFDB:Q38946	0.694	0.936	4.924E-42	411	0.294	0.399	Q38946.pdb.gz	DHE2_ARATH Glutamate dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=1 SV=1
9	AFDB:Q43314	0.702	0.946	1.223E-41	411	0.299	0.406	Q43314.pdb.gz	DHE1_ARATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=1 SV=1
10	AFDB:Q852M0	0.694	0.936	9.721E-41	411	0.278	0.377	Q852M0.pdb.gz	DHE1_ORYSJ Glutamate dehydrogenase 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=GDH1 PE=2 SV=1
11	AFDB:Q33E23	0.691	0.932	1.973E-40	411	0.289	0.392	Q33E23.pdb.gz	DHE2_ORYSJ Glutamate dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=GDH2 PE=2 SV=1
12	PDB:5k12A	0.512	0.959	1.327E-39	294	0.514	0.976	5k12A.pdb.gz
13	PDB:6yehA	0.668	0.896	5.052E-38	410	0.296	0.402	6yehA.pdb.gz	Structural Studies of Glutamate Dehydrogenase (Isoform 1) FromArabidopsis thaliana, an Important Enzyme at the Branch-Point Between Carbon and Nitrogen Metabolism.
14	PDB:3k92A	0.665	0.875	2.869E-34	418	0.269	0.359	3k92A.pdb.gz
15	PDB:7mftA	0.611	0.806	8.725E-34	410	0.276	0.376	7mftA.pdb.gz	A counter-enzyme complex regulates glutamate metabolism in Bacillus subtilis.
16	PDB:3k8zA	0.565	0.799	9.877E-33	378	0.262	0.386	3k8zA.pdb.gz
17	PDB:2yfqB	0.613	0.836	1.480E-32	397	0.254	0.358	2yfqB.pdb.gz
18	PDB:7f79C	0.682	0.823	1.507E-29	458	0.213	0.260	7f79C.pdb.gz	Crystal structure of glutamate dehydrogenase 3 from Candida albicans.
19	PDB:3r3jA	0.646	0.776	2.628E-29	456	0.228	0.279	3r3jA.pdb.gz
20	PDB:3sboC	0.671	0.833	1.325E-28	442	0.203	0.256	3sboC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK14	0.0	1158	558	1.000	1.000	A0A140VK14_HUMAN glutamate dehydrogenase [NAD(P)(+)] OS=Homo sapiens OX=9606 PE=2 SV=1
2	E9KL48	0.0	1110	558	0.957	0.957	E9KL48_HUMAN glutamate dehydrogenase [NAD(P)(+)] OS=Homo sapiens OX=9606 GN=GLUD1 PE=2 SV=1
3	P00366	0.0	1090	558	0.939	0.939	DHE3_BOVIN Glutamate dehydrogenase 1, mitochondrial OS=Bos taurus OX=9913 GN=GLUD1 PE=1 SV=2
4	P00367	0.0	1110	558	0.957	0.957	DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2
5	P10860	0.0	1056	558	0.930	0.930	DHE3_RAT Glutamate dehydrogenase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Glud1 PE=1 SV=2
6	P26443	0.0	1064	558	0.939	0.939	DHE3_MOUSE Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1
7	P49448	0.0	1158	558	1.000	1.000	DHE4_HUMAN Glutamate dehydrogenase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD2 PE=1 SV=2
8	P54385	0.0	769	562	0.658	0.653	DHE3_DROME Glutamate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Gdh PE=1 SV=2
9	Q70PJ6	0.0	838	442	0.695	0.878	Q70PJ6_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh3.2 PE=2 SV=1
10	Q70PJ7	0.0	833	440	0.694	0.880	Q70PJ7_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh3.1 PE=2 SV=1
11	Q8JG17	0.0	912	539	0.783	0.811	Q8JG17_ONCMY glutamate dehydrogenase [NAD(P)(+)] (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh1 PE=2 SV=1
12	Q8JHX9	0.0	923	539	0.790	0.818	Q8JHX9_ONCMY Glutamate dehydrogenase OS=Oncorhynchus mykiss OX=8022 GN=GDH03 PE=2 SV=1
13	Q8JHY1	0.0	955	544	0.814	0.835	Q8JHY1_ONCMY glutamate dehydrogenase [NAD(P)(+)] OS=Oncorhynchus mykiss OX=8022 GN=GDH01 PE=2 SV=1
14	Q54KB7	5.74e-165	480	502	0.450	0.500	DHE3_DICDI Glutamate dehydrogenase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=gluD PE=1 SV=1
15	Q9VCN3	1.40e-161	473	535	0.421	0.439	Q9VCN3_DROME Glutamate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=bb8 PE=1 SV=2
16	Q8JHY0	8.09e-142	410	214	0.341	0.888	Q8JHY0_ONCMY Glutamate dehydrogenase 2 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GDH02 PE=2 SV=1
17	Q8JG16	9.35e-116	343	217	0.306	0.788	Q8JG16_ONCMY Glutamate dehydrogenase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=gdh2 PE=2 SV=1
18	Q43314	1.95e-86	275	411	0.269	0.365	DHE1_ARATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=GDH1 PE=1 SV=1
19	Q38946	4.08e-86	275	411	0.281	0.382	DHE2_ARATH Glutamate dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=GDH2 PE=1 SV=1
20	Q33E23	5.28e-86	274	411	0.271	0.367	DHE2_ORYSJ Glutamate dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=GDH2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	84	13.9	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF00208 ELFV_dehydrog	5.8e-52	188.4	Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
3	PF02812 ELFV_dehydrog_N	5.4e-55	196.1	Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
4	PF07189 SF3b10	2.7e+02	13.1	Splicing factor 3B subunit 10 (SF3b10)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327589

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307900	0.978	Glutamine synthetase
2	9606.ENSP00000359539	0.972	Aspartate aminotransferase, cytoplasmic
3	9606.ENSP00000360268	0.965	Delta-1-pyrroline-5-carboxylate synthase
4	9606.ENSP00000245206	0.961	Aspartate aminotransferase, mitochondrial
5	9606.ENSP00000345282	0.955	Alanine aminotransferase 2
6	9606.ENSP00000293404	0.952	N-acetylglutamate synthase, mitochondrial
7	9606.ENSP00000364490	0.952	Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
8	9606.ENSP00000310447	0.951	Glutaminase liver isoform, mitochondrial
9	9606.ENSP00000317379	0.950	Glutaminase kidney isoform, mitochondrial
10	9606.ENSP00000277865	0.948	Glutamate dehydrogenase 1, mitochondrial
11	9606.ENSP00000378408	0.946	Alanine aminotransferase 1
12	9606.ENSP00000363216	0.944	2-oxoglutarate dehydrogenase-like, mitochondrial
13	9606.ENSP00000402608	0.943	Carbamoyl-phosphate synthase [ammonia], mitochondrial
14	9606.ENSP00000327070	0.936	Malate dehydrogenase, mitochondrial
15	9606.ENSP00000303077	0.935	Putative aspartate aminotransferase, cytoplasmic 2
16	9606.ENSP00000350928	0.935	Glutamate decarboxylase 1
17	9606.ENSP00000365437	0.929	Glutamate decarboxylase 2
18	9606.ENSP00000202967	0.921	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
19	9606.ENSP00000299518	0.921	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
20	9606.ENSP00000377696	0.921	Omega-amidase NIT2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004353	1.000	glutamate dehydrogenase [NAD(P)+] activity
GO:0005515	0.998	protein binding
GO:0042802	0.963	identical protein binding
GO:0097159	0.777	organic cyclic compound binding
GO:1901363	0.773	heterocyclic compound binding
GO:0043167	0.727	ion binding
GO:0004352	0.700	glutamate dehydrogenase (NAD+) activity
GO:0036094	0.579	small molecule binding
GO:0043168	0.534	anion binding
GO:0017076	0.403	purine nucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0009064	0.991	glutamine family amino acid metabolic process
GO:0046395	0.917	carboxylic acid catabolic process
GO:0043648	0.884	dicarboxylic acid metabolic process
GO:0009063	0.867	amino acid catabolic process
GO:0043603	0.800	amide metabolic process
GO:1901606	0.782	alpha-amino acid catabolic process
GO:0006536	0.755	glutamate metabolic process
GO:0009065	0.750	glutamine family amino acid catabolic process
GO:0009058	0.455	biosynthetic process
GO:1901576	0.446	organic substance biosynthetic process
GO:0034641	0.402	cellular nitrogen compound metabolic process
GO:0065007	0.337	biological regulation
GO:0044249	0.322	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.868	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.1.3	1.000	glutamate dehydrogenase [NAD(P)(+)].
RHEA:15133	0.700	H2O + L-glutamate + NAD(+) = 2-oxoglutarate + H(+) + NADH + NH4(+)
EC:1.4.1.2	0.700	glutamate dehydrogenase.

[back to server]