StarFunc result for job id P49450

User Input

>input (140 residues)
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHL
LIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVT
LFPKDVQLARRIRGLEEGLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49450	1.000	1.000	3.435E-21	140	1.000	1.000	P49450.pdb.gz	CENPA_HUMAN Histone H3-like centromeric protein A OS=Homo sapiens OX=9606 GN=CENPA PE=1 SV=1
2	AFDB:O35216	0.696	0.726	5.225E-14	134	0.714	0.746	O35216.pdb.gz	CENPA_MOUSE Histone H3-like centromeric protein A OS=Mus musculus OX=10090 GN=Cenpa PE=2 SV=1
3	PDB:6e0cA	0.674	0.950	2.083E-13	99	0.686	0.970	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
4	AFDB:Q6XXM1	0.642	0.686	3.751E-12	131	0.550	0.588	Q6XXM1.pdb.gz	CENPA_CHICK Histone H3-like centromeric protein A OS=Gallus gallus OX=9031 GN=CENPA PE=1 SV=1
5	AFDB:A8MRL0	0.599	0.512	8.124E-9	164	0.471	0.402	A8MRL0.pdb.gz	A8MRL0_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=H33 PE=3 SV=1
6	AFDB:Q9Y812	0.608	0.707	9.195E-9	120	0.436	0.508	Q9Y812.pdb.gz	CENPA_SCHPO Histone H3-like centromeric protein cnp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnp1 PE=1 SV=1
7	AFDB:O15819	0.609	0.613	1.107E-8	139	0.450	0.453	O15819.pdb.gz	H33A_DICDI Histone H3.3 type a OS=Dictyostelium discoideum OX=44689 GN=H3a PE=1 SV=1
8	AFDB:P0DPK5	0.662	0.633	1.934E-8	147	0.429	0.408	P0DPK5.pdb.gz	H3Y2_HUMAN Histone H3.X OS=Homo sapiens OX=9606 GN=H3Y2 PE=5 SV=1
9	AFDB:Q6T367	0.611	0.523	2.477E-8	164	0.429	0.366	Q6T367.pdb.gz	CENH3_ORYSJ Histone H3-like centromeric protein CENH3 OS=Oryza sativa subsp. japonica OX=39947 GN=CENH3 PE=2 SV=1
10	AFDB:P07041	0.599	0.616	2.636E-8	136	0.429	0.441	P07041.pdb.gz	H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=hh3 PE=1 SV=3
11	AFDB:Q55BN9	0.624	0.642	3.377E-8	136	0.414	0.426	Q55BN9.pdb.gz	H33B_DICDI Histone H3.3 type b OS=Dictyostelium discoideum OX=44689 GN=H3b PE=1 SV=1
12	PDB:1kx5A	0.598	0.620	4.150E-8	135	0.436	0.452	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
13	PDB:5ay8A	0.590	0.847	5.316E-8	97	0.393	0.567	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
14	PDB:7on1e	0.636	0.905	3.012E-7	97	0.364	0.526	7on1e.pdb.gz	Cenp-A nucleosome in complex with Cenp-C
15	PDB:4jjnA	0.596	0.847	3.204E-7	98	0.393	0.561	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
16	PDB:4h9sA	0.481	0.726	1.106E-6	89	0.436	0.685	4h9sA.pdb.gz
17	PDB:7xayD	0.504	0.717	5.202E-6	97	0.321	0.464	7xayD.pdb.gz	Topography of histone H3-H4 interaction with the Hat1-Hat2 acetyltransferase complex.
18	PDB:6xwtA	0.486	0.875	5.416E-4	74	0.236	0.446	6xwtA.pdb.gz
19	PDB:1b67A	0.417	0.808	6.064E-3	68	0.129	0.265	1b67A.pdb.gz
20	PDB:6wjv4	0.439	0.554	3.229E-2	107	0.164	0.215	6wjv4.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49450	4.97e-98	279	140	1.000	1.000	CENPA_HUMAN Histone H3-like centromeric protein A OS=Homo sapiens OX=9606 GN=CENPA PE=1 SV=1
2	O35216	1.07e-60	185	134	0.721	0.754	CENPA_MOUSE Histone H3-like centromeric protein A OS=Mus musculus OX=10090 GN=Cenpa PE=2 SV=1
3	Q6XXM1	9.01e-42	137	131	0.464	0.496	CENPA_CHICK Histone H3-like centromeric protein A OS=Gallus gallus OX=9031 GN=CENPA PE=1 SV=1
4	P59169	9.81e-34	116	136	0.500	0.515	H33_ARATH Histone H3.3 OS=Arabidopsis thaliana OX=3702 GN=HTR4 PE=1 SV=2
5	Q0JCT1	9.81e-34	116	136	0.500	0.515	H33_ORYSJ Histone H3.3 OS=Oryza sativa subsp. japonica OX=39947 GN=H3 PE=1 SV=2
6	A8MRL0	2.99e-33	116	164	0.500	0.427	A8MRL0_ARATH Histone superfamily protein OS=Arabidopsis thaliana OX=3702 GN=H33 PE=3 SV=1
7	Q9LR02	3.22e-33	115	136	0.500	0.515	H3L3_ARATH Histone H3-like 3 OS=Arabidopsis thaliana OX=3702 GN=At1g75600 PE=2 SV=3
8	P59226	8.76e-33	114	136	0.493	0.507	H31_ARATH Histone H3.1 OS=Arabidopsis thaliana OX=3702 GN=HTR2 PE=1 SV=2
9	C1BG88	1.15e-32	114	136	0.493	0.507	C1BG88_ONCMY Histone H3 OS=Oncorhynchus mykiss OX=8022 GN=H33 PE=2 SV=1
10	P02299	1.41e-32	114	136	0.479	0.493	H3_DROME Histone H3 OS=Drosophila melanogaster OX=7227 GN=His3 PE=1 SV=4
11	P84228	1.41e-32	114	136	0.479	0.493	H32_MOUSE Histone H3.2 OS=Mus musculus OX=10090 GN=H3c2 PE=1 SV=2
12	P84233	1.41e-32	114	136	0.479	0.493	H32_XENLA Histone H3.2 OS=Xenopus laevis OX=8355 PE=1 SV=2
13	Q71DI3	1.41e-32	114	136	0.479	0.493	H32_HUMAN Histone H3.2 OS=Homo sapiens OX=9606 GN=H3C15 PE=1 SV=3
14	P68431	1.84e-32	113	136	0.479	0.493	H31_HUMAN Histone H3.1 OS=Homo sapiens OX=9606 GN=H3C1 PE=1 SV=2
15	P68432	1.84e-32	113	136	0.479	0.493	H31_BOVIN Histone H3.1 OS=Bos taurus OX=9913 PE=1 SV=2
16	P68433	1.84e-32	113	136	0.479	0.493	H31_MOUSE Histone H3.1 OS=Mus musculus OX=10090 GN=H3c1 PE=1 SV=2
17	Q6LED0	1.84e-32	113	136	0.479	0.493	H31_RAT Histone H3.1 OS=Rattus norvegicus OX=10116 PE=1 SV=3
18	Q9FXI7	4.57e-32	112	137	0.414	0.423	H3L2_ARATH Histone H3-like 2 OS=Arabidopsis thaliana OX=3702 GN=MGH3 PE=2 SV=3
19	C0HL66	4.84e-32	112	136	0.486	0.500	H33A_DROME Histone H3.3A OS=Drosophila melanogaster OX=7227 GN=His3.3A PE=1 SV=1
20	C0HL67	4.84e-32	112	136	0.486	0.500	H33B_DROME Histone H3.3B OS=Drosophila melanogaster OX=7227 GN=His3.3B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	44	15.7	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF15630 CENP-S	1.5e+02	14.2	CENP-S protein
3	PF15511 CENP-T_C	9.4	17.7	Centromere kinetochore component CENP-T histone fold
4	PF00125 Histone	3e-33	126.2	Core histone H2A/H2B/H3/H4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336868

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244537	0.999	Histone cluster 1 H4 family member f
2	9606.ENSP00000313950	0.999	Aurora kinase B
3	9606.ENSP00000367034	0.999	Histone cluster 1 H4 family member c
4	9606.ENSP00000377007	0.999	Centromere protein N
5	9606.ENSP00000414109	0.999	Holliday junction recognition protein
6	9606.ENSP00000273853	0.998	Centromere protein C
7	9606.ENSP00000332194	0.994	Histone H2A type 2-C
8	9606.ENSP00000443017	0.994	Histone cluster 4, H4
9	9606.ENSP00000216911	0.993	Aurora kinase A
10	9606.ENSP00000457810	0.993	Centromere protein T
11	9606.ENSP00000481486	0.993	Histone cluster 1 H4 family member i
12	9606.ENSP00000484789	0.993	Histone H4
13	9606.ENSP00000347168	0.992	Histone cluster 1 H4 family member j
14	9606.ENSP00000362146	0.992	Borealin
15	9606.ENSP00000366956	0.992	Histone cluster 1 H4 family member h
16	9606.ENSP00000366974	0.992	Histone cluster 1 H4 family member b
17	9606.ENSP00000462355	0.992	Histone cluster 2 H4 family member b
18	9606.ENSP00000462667	0.992	Histone cluster 2 H4 family member a
19	9606.ENSP00000479106	0.992	Histone cluster 1 H4 family member a
20	9606.ENSP00000479461	0.992	Histone cluster 1 H4 family member d

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.911	chromatin binding
GO:0097159	0.602	organic cyclic compound binding
GO:1901363	0.600	heterocyclic compound binding
GO:0003677	0.590	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016043	0.988	cellular component organization
GO:0006996	0.967	organelle organization
GO:0065004	0.945	protein-DNA complex assembly
GO:0006338	0.935	chromatin remodeling
GO:0051276	0.930	chromosome organization
GO:0034508	0.871	centromere complex assembly
GO:1903047	0.853	mitotic cell cycle process
GO:0000226	0.809	microtubule cytoskeleton organization
GO:0034502	0.788	protein localization to chromosome
GO:1902850	0.757	microtubule cytoskeleton organization involved in mitosis
GO:0051234	0.665	establishment of localization
GO:0071459	0.614	protein localization to chromosome, centromeric region
GO:0051653	0.608	spindle localization
GO:0051656	0.598	establishment of organelle localization
GO:0040001	0.591	establishment of mitotic spindle localization
GO:0051383	0.578	kinetochore organization
GO:0000132	0.574	establishment of mitotic spindle orientation
GO:0070925	0.542	organelle assembly
GO:0050789	0.536	regulation of biological process
GO:0140694	0.533	non-membrane-bounded organelle assembly
GO:0050794	0.466	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0000785	0.998	chromatin
GO:0005654	0.998	nucleoplasm
GO:0000775	0.996	chromosome, centromeric region
GO:0005829	0.992	cytosol
GO:0034506	0.982	chromosome, centromeric core domain
GO:0000793	0.979	condensed chromosome
GO:0061638	0.960	CENP-A containing chromatin
GO:0000779	0.957	condensed chromosome, centromeric region
GO:0032993	0.846	protein-DNA complex
GO:0044815	0.789	DNA packaging complex
GO:0000786	0.532	nucleosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]