StarFunc result for job id P49454

User Input

>input (1400 residues)
MSWALEEWKEGLPTRALQKIQELEGQLDKLKKEKQQRQFQLDSLEAALQKQKQKVENEKT
EGTNLKRENQRLMEICESLEKTKQKISHELQVKESQVNFQEGQLNSGKKQIEKLEQELKR
CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKR
LEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQQEKTPSHLSSNSQRTPIRRD
FSASYFSGEQEVTPSRSTLQIGKRDANSSFFDNSSSPHLLDQLKAQNQELRNKINELELR
LQGHEKEMKGQVNKFQELQLQLEKAKVELIEKEKVLNKCRDELVRTTAQYDQASTKYTAL
EQKLKKLTEDLSCQRQNAESARCSLEQKIKEKEKEFQEELSRQQRSFQTLDQECIQMKAR
LTQELQQAKNMHNVLQAELDKLTSVKQQLENNLEEFKQKLCRAEQAFQASQIKENELRRS
MEEMKKENNLLKSHSEQKAREVCHLEAELKNIKQCLNQSQNFAEEMKAKNTSQETMLRDL
QEKINQQENSLTLEKLKLAVADLEKQRDCSQDLLKKREHHIEQLNDKLSKTEKESKALLS
ALELKKKEYEELKEEKTLFSCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQIKSHE
YNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAYMELQQKAEFSDQKHQKEIEN
MCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYESLRDLLKSKDASLVTNEDH
QRSLLAFDQQPAMHHSFANIIGEQGSMPSERSECRLEADQSPKNSAILQNRVDSLEFSLE
SQKQMNSDLQKQCEELVQIKGEIEENLMKAEQMHQSFVAETSQRISKLQEDTSAHQNVVA
ETLSALENKEKELQLLNDKVETEQAEIQELKKSNHLLEDSLKELQLLSETLSLEKKEMSS
IISLNKREIEELTQENGTLKEINASLNQEKMNLIQKSESFANYIDEREKSISELSDQYKQ
EKLILLQRCEETGNAYEDLSQKYKAAQEKNSKLECLLNECTSLCENRKNELEQLKEAFAK
EHQEFLTKLAFAEERNQNLMLELETVQQALRSEMTDNQNNSKSEAGGLKQEIMTLKEEQN
KMQKEVNDLLQENEQLMKVMKTKHECQNLESEPIRNSVKERESERNQCNFKPQMDLEVKE
ISLDSYNAQLVQLEAMLRNKELKLQESEKEKECLQHELQTIRGDLETSNLQDMQSQEISG
LKDCEIDAEEKYISGPHELSTSQNDNAHLQCSLQTTMNKLNELEKICEILQAEKYELVTE
LNDSRSECITATRKMAEEVGKLLNEVKILNDDSGLLHGELVEDIPGGEFGEQPNEQHPVS
LAPLDESNSYEHLTLSDKEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY14	0.135	0.187	3.594E-78	952	0.501	0.736	E9PY14.pdb.gz	E9PY14_MOUSE Centromere protein F (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1
2	AFDB:Q61595	0.090	0.093	2.220E-4	1327	0.139	0.147	Q61595.pdb.gz	KTN1_MOUSE Kinectin OS=Mus musculus OX=10090 GN=Ktn1 PE=1 SV=1
3	AFDB:Q9QYE6	0.104	0.186	8.657E-4	729	0.090	0.173	Q9QYE6.pdb.gz	GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus OX=10090 GN=Golga5 PE=1 SV=2
4	AFDB:Q57Z65	0.063	0.071	5.315E-3	1188	0.136	0.161	Q57Z65.pdb.gz	Q57Z65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.380 PE=4 SV=1
5	AFDB:Q92351	0.080	0.089	5.733E-3	1208	0.154	0.178	Q92351.pdb.gz	PCP1_SCHPO Spindle pole body protein pcp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pcp1 PE=1 SV=1
6	AFDB:Q9Z221	0.131	0.175	6.183E-3	971	0.117	0.169	Q9Z221.pdb.gz	PMFBP_RAT Polyamine-modulated factor 1-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pmfbp1 PE=2 SV=2
7	AFDB:Q54NP8	0.068	0.051	9.733E-3	1922	0.160	0.117	Q54NP8.pdb.gz	KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum OX=44689 GN=kif4 PE=2 SV=1
8	AFDB:Q960Y8	0.134	0.197	1.221E-2	874	0.075	0.120	Q960Y8.pdb.gz	Q960Y8_DROME Aluminum tubes, isoform G OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
9	AFDB:Q8CGB3	0.075	0.075	1.421E-2	1411	0.155	0.154	Q8CGB3.pdb.gz	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
10	AFDB:P59242	0.096	0.111	1.532E-2	1191	0.153	0.180	P59242.pdb.gz	CING_MOUSE Cingulin OS=Mus musculus OX=10090 GN=Cgn PE=1 SV=1
11	PDB:6qw64A	0.026	0.072	4.599	239	0.009	0.054	6qw64A.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:7a5fo3	0.021	0.228	5.771	94	0.009	0.128	7a5fo3.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
13	PDB:4v96AA	0.035	0.117	6.224	299	0.008	0.037	4v96AA.pdb.gz
14	PDB:6ke6RC	0.028	0.129	8.422	278	0.014	0.072	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PY14	0.0	1277	952	0.502	0.738	E9PY14_MOUSE Centromere protein F (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1
2	E9Q3P4	0.0	1761	2997	0.695	0.325	E9Q3P4_MOUSE Centromere protein F OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1
3	P49454	0.0	2798	3114	1.000	0.450	CENPF_HUMAN Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3
4	Q155P7	0.0	1763	2997	0.695	0.325	Q155P7_MOUSE LEK1 OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1
5	Q8C0X4	0.0	1272	952	0.501	0.736	Q8C0X4_MOUSE Centromere protein Cenp-F N-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=2 SV=1
6	Q9QZ84	0.0	1014	2473	0.409	0.232	Q9QZ84_MOUSE LEK1 (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=2 SV=1
7	A0A286Y8J7	2.17e-180	596	2675	0.347	0.182	A0A286Y8J7_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=1
8	F1Q7X5	2.34e-180	596	2708	0.347	0.179	F1Q7X5_DANRE Centromere protein F OS=Danio rerio OX=7955 GN=cenpf PE=1 SV=2
9	Q8BV30	3.17e-159	483	320	0.179	0.781	Q8BV30_MOUSE Centromere protein Cenp-F N-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=2 SV=2
10	Q3TNJ4	1.23e-147	452	296	0.166	0.784	Q3TNJ4_MOUSE Centromere protein Cenp-F N-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cenpf PE=2 SV=1
11	E9Q776	2.02e-26	106	88	0.038	0.602	E9Q776_MOUSE Centromere protein F OS=Mus musculus OX=10090 GN=Cenpf PE=1 SV=1
12	P40457	0.071	40.0	1679	0.047	0.039	MLP2_YEAST Protein MLP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLP2 PE=1 SV=1
13	Q9QYE6	0.22	38.5	729	0.040	0.077	GOGA5_MOUSE Golgin subfamily A member 5 OS=Mus musculus OX=10090 GN=Golga5 PE=1 SV=2
14	E7F2X0	0.25	38.5	1569	0.081	0.072	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
15	Q6IVW2	0.29	38.1	675	0.039	0.081	Q6IVW2_DANRE IFT81 OS=Danio rerio OX=7955 GN=cdv1 PE=1 SV=1
16	P41541	0.51	37.4	961	0.043	0.062	USO1_BOVIN General vesicular transport factor p115 OS=Bos taurus OX=9913 GN=USO1 PE=1 SV=1
17	Q5VU43	0.67	37.0	2346	0.045	0.027	MYOME_HUMAN Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3
18	Q55GG3	1.0	36.2	818	0.034	0.059	Q55GG3_DICDI Ubiquitin-like domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268498 PE=4 SV=2
19	Q9LFE4	1.1	36.2	853	0.026	0.042	Y5673_ARATH WEB family protein At5g16730, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g16730 PE=1 SV=1
20	O16844	2.3	35.0	1201	0.036	0.042	COS_DROME Kinesin-like protein costa OS=Drosophila melanogaster OX=7227 GN=cos PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10481 CENP-F_N	5.9e-146	497.4	Cenp-F N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355922

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302530	0.998	Mitotic checkpoint serine/threonine-protein kinase BUB1
2	9606.ENSP00000287598	0.997	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
3	9606.ENSP00000265148	0.995	Centromere-associated protein E
4	9606.ENSP00000342307	0.992	Forkhead box protein M1
5	9606.ENSP00000261597	0.991	Kinetochore protein NDC80 homolog
6	9606.ENSP00000261396	0.990	Nuclear pore complex protein Nup133
7	9606.ENSP00000411532	0.986	DNA topoisomerase 2-alpha
8	9606.ENSP00000356379	0.985	Abnormal spindle-like microcephaly-associated protein
9	9606.ENSP00000256442	0.984	G2/mitotic-specific cyclin-B1
10	9606.ENSP00000319417	0.978	Spindle and kinetochore-associated protein 3
11	9606.ENSP00000453403	0.977	Nucleolar and spindle-associated protein 1
12	9606.ENSP00000357643	0.975	Proliferation marker protein Ki-67
13	9606.ENSP00000247191	0.969	Disks large-associated protein 5
14	9606.ENSP00000358813	0.967	Dual specificity protein kinase TTK
15	9606.ENSP00000260731	0.966	Kinesin-like protein KIF11
16	9606.ENSP00000265295	0.966	Protein Spindly
17	9606.ENSP00000360540	0.966	Centrosomal protein of 55 kDa
18	9606.ENSP00000378356	0.963	Kinesin-like protein KIF20A
19	9606.ENSP00000285116	0.962	Spindle and kinetochore-associated protein 1
20	9606.ENSP00000251496	0.961	Condensin complex subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.950	cellular process
GO:0050789	0.940	regulation of biological process
GO:0007049	0.781	cell cycle
GO:0051179	0.674	localization
GO:0050794	0.395	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005634	0.998	nucleus
GO:0015630	0.998	microtubule cytoskeleton
GO:0097539	0.997	ciliary transition fiber
GO:0005654	0.986	nucleoplasm
GO:0005694	0.977	chromosome
GO:0012505	0.929	endomembrane system
GO:0005829	0.877	cytosol
GO:0000793	0.793	condensed chromosome
GO:0099080	0.772	supramolecular complex
GO:0005813	0.769	centrosome
GO:0098687	0.757	chromosomal region
GO:0000775	0.750	chromosome, centromeric region
GO:0000779	0.588	condensed chromosome, centromeric region
GO:0000776	0.563	kinetochore
GO:0016020	0.502	membrane
GO:0036064	0.462	ciliary basal body
GO:0099568	0.431	cytoplasmic region
GO:0097014	0.418	ciliary plasm
GO:0005930	0.379	axoneme
GO:0005819	0.358	spindle
GO:0045120	0.349	pronucleus
GO:0099086	0.323	synaptonemal structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]