StarFunc result for job id P49459

User Input

>input (152 residues)
MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFT
EEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS
PANSQAAQLYQENKREYEKRVSAIVEQSWRDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49459	1.000	1.000	4.782E-34	152	1.000	1.000	P49459.pdb.gz	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
2	AFDB:P25153	0.990	0.997	6.808E-31	151	0.875	0.881	P25153.pdb.gz	UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc6 PE=2 SV=2
3	PDB:6cyrA	0.977	0.971	9.851E-31	153	0.993	0.987	6cyrA.pdb.gz
4	AFDB:P52478	0.991	0.785	1.785E-30	192	0.842	0.667	P52478.pdb.gz	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
5	AFDB:P25865	0.984	0.984	3.183E-30	152	0.757	0.757	P25865.pdb.gz	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1
6	AFDB:P42746	0.976	0.989	2.488E-29	150	0.717	0.727	P42746.pdb.gz	UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana OX=3702 GN=UBC3 PE=2 SV=1
7	AFDB:P23566	0.985	0.991	5.797E-28	151	0.711	0.715	P23566.pdb.gz	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
8	PDB:2aakA	0.965	0.978	9.041E-27	150	0.757	0.767	2aakA.pdb.gz
9	AFDB:P06104	0.986	0.872	1.441E-26	172	0.691	0.610	P06104.pdb.gz	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
10	AFDB:O74201	0.989	0.840	1.747E-26	179	0.691	0.587	O74201.pdb.gz	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
11	PDB:7meyB	0.936	0.930	9.536E-22	153	0.678	0.673	7meyB.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
12	AFDB:O00102	0.915	0.839	2.738E-20	166	0.401	0.367	O00102.pdb.gz	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2
13	AFDB:P60604	0.946	0.874	1.655E-19	165	0.414	0.382	P60604.pdb.gz	UB2G2_HUMAN Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1
14	PDB:3ptfA	0.889	0.884	2.936E-18	153	0.375	0.373	3ptfA.pdb.gz
15	PDB:2cyxA	0.920	0.829	3.338E-18	169	0.408	0.367	2cyxA.pdb.gz
16	PDB:4m1nC	0.891	0.848	3.338E-18	160	0.421	0.400	4m1nC.pdb.gz
17	PDB:6op8A	0.932	0.850	5.234E-18	167	0.401	0.365	6op8A.pdb.gz
18	PDB:5aieB	0.917	0.928	1.287E-17	150	0.349	0.353	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
19	PDB:3bzhA	0.907	0.858	1.892E-17	161	0.355	0.335	3bzhA.pdb.gz
20	PDB:6d68A	0.896	0.858	2.018E-17	159	0.329	0.314	6d68A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49459	8.17e-113	318	152	1.000	1.000	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
2	Q9Z255	8.17e-113	318	152	1.000	1.000	UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus OX=10090 GN=Ube2a PE=1 SV=1
3	P63146	3.52e-107	303	152	0.954	0.954	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1
4	P63147	3.52e-107	303	152	0.954	0.954	UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus OX=10090 GN=Ube2b PE=1 SV=1
5	P63149	3.52e-107	303	152	0.954	0.954	UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus OX=10116 GN=Ube2b PE=2 SV=1
6	P25153	6.25e-99	283	151	0.875	0.881	UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster OX=7227 GN=Ubc6 PE=2 SV=2
7	P52478	3.46e-98	282	192	0.842	0.667	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
8	P25865	2.33e-89	258	152	0.757	0.757	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1
9	P42745	8.06e-89	257	152	0.750	0.750	UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana OX=3702 GN=UBC2 PE=2 SV=1
10	P42746	1.24e-83	244	150	0.717	0.727	UBC3_ARATH Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana OX=3702 GN=UBC3 PE=2 SV=1
11	P23566	3.04e-82	240	151	0.711	0.715	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
12	P06104	1.38e-78	232	172	0.684	0.605	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
13	O74201	8.34e-78	230	179	0.684	0.581	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
14	P35133	2.11e-42	139	148	0.395	0.405	UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana OX=3702 GN=UBC10 PE=1 SV=1
15	F4JKF3	6.61e-42	139	178	0.395	0.337	F4JKF3_ARATH Ubiquitin conjugating enzyme 9 OS=Arabidopsis thaliana OX=3702 GN=UBC9 PE=3 SV=1
16	P35131	7.14e-42	138	148	0.388	0.399	UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana OX=3702 GN=UBC8 PE=1 SV=1
17	Q8S920	7.99e-42	138	147	0.388	0.401	UBC5A_ORYSJ Ubiquitin-conjugating enzyme E2 5A OS=Oryza sativa subsp. japonica OX=39947 GN=UBC5A PE=2 SV=1
18	Q9SLE4	1.48e-41	137	148	0.388	0.399	UBC29_ARATH Ubiquitin-conjugating enzyme E2 29 OS=Arabidopsis thaliana OX=3702 GN=UBC29 PE=2 SV=1
19	Q84K93	2.01e-41	137	148	0.382	0.392	Q84K93_GOSHI Ubiquitin-conjugating enzyme E2 OS=Gossypium hirsutum OX=3635 GN=UBC2 PE=2 SV=1
20	Q9FKT3	2.13e-41	137	148	0.408	0.419	UBC30_ARATH Ubiquitin-conjugating enzyme E2 30 OS=Arabidopsis thaliana OX=3702 GN=UBC30 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14461 Prok-E2_B	3.1e+02	12.7	Prokaryotic E2 family B
2	PF05773 RWD	0.78	21.4	RWD domain
3	PF05743 UEV	74	14.6	UEV domain
4	PF00179 UQ_con	4.6e-51	183.6	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 144197.XP_008274305.1

Rank	PPI partner	STRING score	Description
1	144197.XP_008291369.1	0.975	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
2	144197.XP_008295091.1	0.975	E3 ubiquitin-protein ligase RAD18
3	144197.XP_008301926.1	0.973	E3 ubiquitin-protein ligase BRE1B isoform X1
4	144197.XP_008287523.1	0.910	Belongs to the ubiquitin-activating E1 family.
5	144197.XP_008281153.1	0.900	Belongs to the ubiquitin-conjugating enzyme family.
6	144197.XP_008294225.1	0.900	Belongs to the ubiquitin-conjugating enzyme family.
7	144197.XP_008276656.1	0.898	Ubiquitin-like modifier-activating enzyme 6
8	144197.XP_008281743.1	0.895	Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N- terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
9	144197.XP_008292060.1	0.889	Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N- terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
10	144197.XP_008275925.1	0.880	Ubiquitin-conjugating enzyme E2 variant 1
11	144197.XP_008286554.1	0.877	ubiquitin-40S ribosomal protein S27a
12	144197.XP_008300924.1	0.857	RNA polymerase-associated protein RTF1 homolog
13	144197.XP_008279789.1	0.854	This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand
14	144197.XP_008283973.1	0.845	UBX domain-containing protein 7
15	144197.XP_008292068.1	0.833	Uncharacterized protein LOC103366189
16	144197.XP_008284896.1	0.820	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 95 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
17	144197.XP_008284378.1	0.811	Belongs to the ubiquitin-activating E1 family.
18	144197.XP_008278997.1	0.810	Polyubiquitin
19	144197.XP_008296785.1	0.810	Ubiquitin-conjugating enzyme E2 variant 2
20	144197.XP_008300055.1	0.810	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 208 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061631	0.999	ubiquitin conjugating enzyme activity
GO:0031625	0.998	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0044260	0.973	cellular macromolecule metabolic process
GO:0019538	0.971	protein metabolic process
GO:0043412	0.875	macromolecule modification
GO:0036211	0.823	protein modification process
GO:0070647	0.813	protein modification by small protein conjugation or removal
GO:0032446	0.804	protein modification by small protein conjugation
GO:0016567	0.611	protein ubiquitination
GO:0006508	0.552	proteolysis
GO:0043632	0.551	modification-dependent macromolecule catabolic process
GO:0019941	0.543	modification-dependent protein catabolic process
GO:0050896	0.477	response to stimulus
GO:0065007	0.416	biological regulation
GO:0050794	0.397	regulation of cellular process
GO:0000209	0.374	protein polyubiquitination
GO:0051716	0.372	cellular response to stimulus
GO:1901360	0.367	organic cyclic compound metabolic process
GO:0034641	0.362	cellular nitrogen compound metabolic process
GO:0006511	0.358	ubiquitin-dependent protein catabolic process
GO:0006950	0.354	response to stress
GO:0006725	0.353	cellular aromatic compound metabolic process
GO:0033554	0.326	cellular response to stress
GO:0090304	0.317	nucleic acid metabolic process
GO:0060255	0.305	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005634	0.999	nucleus
GO:0031981	0.986	nuclear lumen
GO:0005694	0.984	chromosome
GO:0005654	0.984	nucleoplasm
GO:0032991	0.950	protein-containing complex
GO:0005829	0.933	cytosol
GO:1990234	0.924	transferase complex
GO:0000785	0.868	chromatin
GO:0140535	0.786	intracellular protein-containing complex
GO:0000803	0.772	sex chromosome
GO:0031371	0.754	ubiquitin conjugating enzyme complex
GO:0001741	0.691	XY body
GO:0000151	0.386	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	0.999	E2 ubiquitin-conjugating enzyme.

[back to server]