StarFunc result for job id P49588

User Input

>input (968 residues)
MDSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGGDEAAGLEADLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREADGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEV
TDDSPKYNYHLDSSGSYVFENTVATVMALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVWLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKAVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKCLSVMEAK
VKAQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LRLGDVKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BPK7	0.521	0.505	0.000	999	0.998	0.967	H3BPK7.pdb.gz	H3BPK7_HUMAN Alanine--tRNA ligase OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=4
2	AFDB:O13914	0.472	0.476	0.000	959	0.473	0.478	O13914.pdb.gz	SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ala1 PE=1 SV=1
3	AFDB:P36428	0.473	0.457	0.000	1003	0.478	0.462	P36428.pdb.gz	SYA_ARATH Alanine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=ALATS PE=1 SV=3
4	AFDB:P40825	0.646	0.638	0.000	983	0.495	0.487	P40825.pdb.gz	SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALA1 PE=1 SV=3
5	AFDB:P49588	1.000	1.000	0.000	968	1.000	1.000	P49588.pdb.gz	SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2
6	AFDB:Q5A8K2	0.655	0.654	0.000	969	0.497	0.496	Q5A8K2.pdb.gz	SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALA1 PE=1 SV=1
7	AFDB:Q5JTZ9	0.480	0.472	0.000	985	0.457	0.449	Q5JTZ9.pdb.gz	SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1
8	AFDB:Q9VLM8	0.485	0.486	0.000	966	0.608	0.610	Q9VLM8.pdb.gz	SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AlaRS PE=2 SV=1
9	AFDB:Q14CH7	0.478	0.473	2.537E-103	980	0.455	0.449	Q14CH7.pdb.gz	SYAM_MOUSE Alanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Aars2 PE=1 SV=1
10	AFDB:Q583T3	0.450	0.450	4.823E-101	966	0.442	0.443	Q583T3.pdb.gz	Q583T3_TRYB2 Alanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.610 PE=3 SV=1
11	PDB:3wqyA	0.330	0.350	9.035E-39	905	0.219	0.234	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
12	PDB:2e1bA	0.193	0.822	2.965E-11	216	0.055	0.245	2e1bA.pdb.gz
13	PDB:3rfnA	0.138	0.823	1.611E-7	151	0.028	0.179	3rfnA.pdb.gz	Computational design of high-affinity epitope scaffolds by backbone grafting of a linear epitope.
14	PDB:1v4pC	0.136	0.795	1.125E-6	155	0.032	0.200	1v4pC.pdb.gz	Crystal structure of alanyl-tRNA synthetase editing-domain homolog (PH0574) from a hyperthermophile, Pyrococcus horikoshii OT3 at 1.45 A resolution
15	PDB:7eivB	0.170	0.496	2.221E-6	300	0.055	0.177	7eivB.pdb.gz	X-shaped structure of bacterial heterotetrameric tRNA synthetase suggests cryptic prokaryote functions and a rationale for synthetase classifications.
16	PDB:1qf6A	0.145	0.208	1.977E-5	641	0.053	0.080	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
17	PDB:6chdA	0.145	0.258	4.021E-4	506	0.042	0.081	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
18	PDB:1bbuA	0.142	0.257	5.127E-4	486	0.048	0.095	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
19	PDB:5mguA	0.132	0.281	5.127E-4	407	0.043	0.103	5mguA.pdb.gz	Kinetic and structural changes in HsmtPheRS, induced by pathogenic mutations in human FARS2.
20	PDB:2du3A	0.117	0.199	7.562E-4	534	0.031	0.056	2du3A.pdb.gz	Structural insights into the first step of RNA-dependent cysteine biosynthesis in archaea.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7ZQC5	0.0	563	876	0.386	0.427	SYA_ECO24 Alanine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=alaS PE=3 SV=1
2	H3BPK7	0.0	1986	999	1.000	0.969	H3BPK7_HUMAN Alanine--tRNA ligase OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=4
3	O13914	0.0	889	959	0.480	0.485	SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ala1 PE=1 SV=1
4	P00957	0.0	563	876	0.386	0.427	SYA_ECOLI Alanine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=alaS PE=1 SV=2
5	P36428	0.0	872	1003	0.489	0.472	SYA_ARATH Alanine--tRNA ligase OS=Arabidopsis thaliana OX=3702 GN=ALATS PE=1 SV=3
6	P40825	0.0	936	983	0.494	0.486	SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALA1 PE=1 SV=3
7	P49588	0.0	2005	968	1.000	1.000	SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2
8	P50475	0.0	1920	968	0.951	0.951	SYAC_RAT Alanine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Aars1 PE=1 SV=3
9	Q14CH7	0.0	808	980	0.454	0.448	SYAM_MOUSE Alanine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Aars2 PE=1 SV=1
10	Q583T3	0.0	760	966	0.439	0.440	Q583T3_TRYB2 Alanine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3D8.610 PE=3 SV=1
11	Q5A8K2	0.0	925	969	0.504	0.504	SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALA1 PE=1 SV=1
12	Q5JTZ9	0.0	808	985	0.457	0.449	SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=AARS2 PE=1 SV=1
13	Q8BGQ7	0.0	1926	968	0.956	0.956	SYAC_MOUSE Alanine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Aars1 PE=1 SV=1
14	Q8ID31	0.0	633	1408	0.389	0.268	Q8ID31_PLAF7 Alanine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1367700 PE=3 SV=1
15	Q9VLM8	0.0	1204	966	0.607	0.609	SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=AlaRS PE=2 SV=1
16	Q9VRJ1	5.89e-164	509	1012	0.376	0.360	SYAM_DROME Alanine--tRNA ligase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=AlaRS-m PE=2 SV=1
17	Q9FFC7	2.81e-152	477	978	0.355	0.352	SYAP_ARATH Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB86 PE=1 SV=2
18	P9WFW7	5.34e-138	437	904	0.347	0.372	SYA_MYCTU Alanine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=alaS PE=1 SV=1
19	Q57984	9.19e-55	207	892	0.259	0.281	SYA_METJA Alanine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=alaS PE=1 SV=1
20	O58035	4.98e-50	193	915	0.236	0.249	SYA_PYRHO Alanine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=alaS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02272 DHHA1	6e-16	70.5	DHHA1 domain
2	PF09177 Syntaxin-6_N	59	15.5	Syntaxin 6, N-terminal
3	PF01411 tRNA-synt_2c	2.1e-224	757.8	tRNA synthetases class II (A)
4	PF07973 tRNA_SAD	8.1e-14	62.8	Threonyl and Alanyl tRNA synthetase second additional domain
5	PF15358 TSKS	38	14.2	Testis-specific serine kinase substrate

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373918	0.996	Glycine--tRNA ligase
2	9606.ENSP00000362576	0.991	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000364794	0.991	Isoleucine--tRNA ligase, cytoplasmic
4	9606.ENSP00000256854	0.989	Asparagine--tRNA ligase, cytoplasmic
5	9606.ENSP00000355890	0.988	Bifunctional glutamate/proline--tRNA ligase
6	9606.ENSP00000377954	0.984	Leucine--tRNA ligase, cytoplasmic
7	9606.ENSP00000325448	0.980	Lysine--tRNA ligase
8	9606.ENSP00000234677	0.975	Serine--tRNA ligase, cytoplasmic
9	9606.ENSP00000425634	0.974	Histidine--tRNA ligase, cytoplasmic
10	9606.ENSP00000307567	0.969	Glutamine--tRNA ligase
11	9606.ENSP00000262027	0.967	Methionine--tRNA ligase, cytoplasmic
12	9606.ENSP00000264161	0.956	Aspartate--tRNA ligase, cytoplasmic
13	9606.ENSP00000320658	0.955	Tyrosine--tRNA ligase, mitochondrial
14	9606.ENSP00000408576	0.954	Probable leucine--tRNA ligase, mitochondrial
15	9606.ENSP00000338093	0.952	Probable threonine--tRNA ligase 2, cytoplasmic
16	9606.ENSP00000355889	0.951	Isoleucine--tRNA ligase, mitochondrial
17	9606.ENSP00000360327	0.930	Probable proline--tRNA ligase, mitochondrial
18	9606.ENSP00000441000	0.929	Valine--tRNA ligase, mitochondrial
19	9606.ENSP00000387710	0.920	Threonine--tRNA ligase, cytoplasmic
20	9606.ENSP00000316335	0.918	Phenylalanine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0004813	0.999	alanine-tRNA ligase activity
GO:1901363	0.988	heterocyclic compound binding
GO:0097159	0.988	organic cyclic compound binding
GO:0052689	0.987	carboxylic ester hydrolase activity
GO:0002161	0.983	aminoacyl-tRNA editing activity
GO:0003723	0.980	RNA binding
GO:0000049	0.954	tRNA binding
GO:0005515	0.887	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0034660	0.988	ncRNA metabolic process
GO:0006412	0.988	translation
GO:0019752	0.987	carboxylic acid metabolic process
GO:0006418	0.980	tRNA aminoacylation for protein translation
GO:0006419	0.414	alanyl-tRNA aminoacylation
GO:0065007	0.333	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.941	cytosol
GO:0043227	0.876	membrane-bounded organelle
GO:0043233	0.865	organelle lumen
GO:0043231	0.822	intracellular membrane-bounded organelle
GO:0070013	0.796	intracellular organelle lumen
GO:0005634	0.444	nucleus
GO:1903561	0.316	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12540	0.999	ATP + L-alanine + tRNA(Ala) = AMP + diphosphate + L-alanyl-tRNA(Ala)
EC:6.1.1.7	0.999	alanine--tRNA ligase.
EC:3.1.1.-	0.987	Carboxylic ester hydrolases.

[back to server]