StarFunc result for job id P49589

User Input

>input (748 residues)
MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVY
DASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRP
EAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVN
SCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTR
VSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEG
EGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSAMAGTLLGASM
DIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDA
LKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQF
EKWGEEEAELNKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPN
QALLENIALYLTHMLKIFGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRK
IAREQKVPEILQLSDALRDNILPELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVEEE
KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQ
AKKLKKLFEAQEKLYKEYLQMAQNGSFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCG3	0.965	0.965	0.000	748	1.000	1.000	A0A024RCG3.pdb.gz
2	AFDB:Q7KN90	0.928	0.936	3.965E-85	741	0.587	0.592	Q7KN90.pdb.gz	SYCC_DROME Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=CysRS PE=1 SV=1
3	AFDB:P53852	0.730	0.713	6.260E-67	767	0.443	0.432	P53852.pdb.gz	SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL247W PE=1 SV=1
4	AFDB:Q09860	0.800	0.794	1.341E-63	754	0.441	0.438	Q09860.pdb.gz	SYC_SCHPO Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29E6.06c PE=3 SV=1
5	AFDB:Q585F2	0.764	0.729	8.518E-61	785	0.392	0.373	Q585F2.pdb.gz	Q585F2_TRYB2 cysteine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.350 PE=3 SV=1
6	AFDB:Q54KR1	0.615	0.695	3.631E-60	660	0.414	0.470	Q54KR1.pdb.gz	SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=cysS PE=3 SV=1
7	AFDB:C8V9N8	0.785	0.711	1.255E-57	833	0.429	0.385	C8V9N8.pdb.gz	C8V9N8_EMENI cysteine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08800 PE=3 SV=1
8	AFDB:Q8IJP3	0.650	0.715	2.237E-50	677	0.328	0.362	Q8IJP3.pdb.gz	Q8IJP3_PLAF7 cysteine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1015200.1 PE=3 SV=2
9	AFDB:E7FC09	0.588	0.769	7.778E-40	566	0.271	0.359	E7FC09.pdb.gz	E7FC09_DANRE cysteine--tRNA ligase OS=Danio rerio OX=7955 GN=cars2 PE=1 SV=1
10	AFDB:F4IPY2	0.513	0.673	6.540E-37	563	0.242	0.321	F4IPY2.pdb.gz	SYCM_ARATH Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYCO PE=2 SV=1
11	PDB:1u0bB	0.515	0.806	8.905E-33	461	0.229	0.371	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
12	PDB:1li7B	0.434	0.842	2.774E-29	375	0.191	0.381	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
13	PDB:6ax8A	0.391	0.555	5.797E-11	509	0.096	0.141	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
14	PDB:4r3zB	0.380	0.426	1.531E-9	659	0.100	0.114	4r3zB.pdb.gz
15	PDB:5yymA	0.374	0.469	4.283E-9	581	0.100	0.129	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
16	PDB:1f7uA	0.382	0.459	6.525E-9	606	0.091	0.112	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
17	PDB:5b63C	0.369	0.480	1.892E-7	553	0.098	0.132	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
18	PDB:4ariA	0.308	0.283	2.478E-6	821	0.115	0.105	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
19	PDB:7d5cA	0.240	0.200	2.596E-6	919	0.104	0.085	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
20	PDB:6lpfB	0.265	0.202	1.334E-5	1006	0.072	0.054	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DKY1	0.0	1454	739	0.930	0.942	B4DKY1_HUMAN cysteine--tRNA ligase OS=Homo sapiens OX=9606 GN=CARS1 PE=1 SV=1
2	C8V9N8	0.0	541	833	0.448	0.402	C8V9N8_EMENI cysteine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08800 PE=3 SV=1
3	P49589	0.0	1561	748	1.000	1.000	SYCC_HUMAN Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1 PE=1 SV=3
4	P53852	0.0	607	767	0.451	0.439	SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL247W PE=1 SV=1
5	Q09860	0.0	575	754	0.445	0.442	SYC_SCHPO Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29E6.06c PE=3 SV=1
6	Q7KN90	0.0	826	741	0.584	0.590	SYCC_DROME Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=CysRS PE=1 SV=1
7	Q585F2	3.87e-177	528	785	0.398	0.380	Q585F2_TRYB2 cysteine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.350 PE=3 SV=1
8	Q54KR1	1.56e-158	476	660	0.334	0.379	SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=cysS PE=3 SV=1
9	Q8IJP3	5.46e-107	343	677	0.257	0.284	Q8IJP3_PLAF7 cysteine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1015200.1 PE=3 SV=2
10	E7FC09	9.47e-82	273	566	0.231	0.306	E7FC09_DANRE cysteine--tRNA ligase OS=Danio rerio OX=7955 GN=cars2 PE=1 SV=1
11	Q7K3P0	4.60e-62	219	558	0.202	0.271	Q7K3P0_DROME cysteine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=CysRS-m PE=2 SV=1
12	F4IPY2	4.04e-61	217	563	0.163	0.217	SYCM_ARATH Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYCO PE=2 SV=1
13	A0A1D6LAG9	1.66e-55	202	564	0.142	0.188	CPS1_MAIZE Cysteine--tRNA ligase CPS1, chloroplastic/mitochondrial OS=Zea mays OX=4577 GN=CPS1 PE=2 SV=1
14	P21888	1.17e-54	197	461	0.132	0.215	SYC_ECOLI Cysteine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=cysS PE=1 SV=2
15	P9WFW1	6.15e-54	195	469	0.154	0.245	SYC_MYCTU Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cysS PE=1 SV=1
16	Q9CEJ0	1.07e-50	186	448	0.124	0.208	SYC_LACLA Cysteine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=cysS PE=3 SV=1
17	B3LFA4	2.05e-48	181	511	0.148	0.217	SYCC2_ARATH Cysteine--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g38830 PE=2 SV=1
18	P9WJM9	3.24e-32	132	414	0.104	0.188	MSHC_MYCTU L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mshC PE=1 SV=1
19	Q10490	1.65e-04	47.8	1111	0.043	0.029	SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lrs1 PE=1 SV=1
20	O27552	0.004	43.1	937	0.045	0.036	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18305 DNA_pol_A_exoN	2.9e+02	13.2	3' to 5' exonuclease C-terminal domain
2	PF00480 ROK	6.7e+02	11.1	ROK family
3	PF00133 tRNA-synt_1	8	16.2	tRNA synthetases class I (I, L, M and V)
4	PF00749 tRNA-synt_1c	2.3e+02	12.1	tRNA synthetases class I (E and Q), catalytic domain
5	PF01406 tRNA-synt_1e	2.7e-122	419.5	tRNA synthetases class I (C) catalytic domain
6	PF09334 tRNA-synt_1g	0.0031	28.0	tRNA synthetases class I (M)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369897

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331901	0.998	Elongation factor 1-gamma
2	9606.ENSP00000362576	0.979	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000377954	0.976	Leucine--tRNA ligase, cytoplasmic
4	9606.ENSP00000355890	0.974	Bifunctional glutamate/proline--tRNA ligase
5	9606.ENSP00000364794	0.970	Isoleucine--tRNA ligase, cytoplasmic
6	9606.ENSP00000262027	0.967	Methionine--tRNA ligase, cytoplasmic
7	9606.ENSP00000234677	0.962	Serine--tRNA ligase, cytoplasmic
8	9606.ENSP00000302896	0.960	Ribosomal protein S9
9	9606.ENSP00000307889	0.940	Ribosomal protein L13
10	9606.ENSP00000364815	0.936	Valine--tRNA ligase
11	9606.ENSP00000379888	0.935	Ribosomal protein S8
12	9606.ENSP00000355889	0.934	Isoleucine--tRNA ligase, mitochondrial
13	9606.ENSP00000341885	0.933	Ribosomal protein S2
14	9606.ENSP00000307567	0.931	Glutamine--tRNA ligase
15	9606.ENSP00000429374	0.930	Ribosomal protein S20
16	9606.ENSP00000373918	0.929	Glycine--tRNA ligase
17	9606.ENSP00000278572	0.928	40S ribosomal protein S3
18	9606.ENSP00000449328	0.926	60S acidic ribosomal protein P0
19	9606.ENSP00000467466	0.925	Ribosomal protein S15
20	9606.ENSP00000311430	0.923	L ribosomal proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004817	1.000	cysteine-tRNA ligase activity
GO:0035639	0.995	purine ribonucleoside triphosphate binding
GO:0032559	0.995	adenyl ribonucleotide binding
GO:0005524	0.991	ATP binding
GO:0003676	0.931	nucleic acid binding
GO:0005515	0.926	protein binding
GO:0003723	0.912	RNA binding
GO:0000049	0.828	tRNA binding
GO:0046983	0.757	protein dimerization activity
GO:0042802	0.724	identical protein binding
GO:0042803	0.639	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0034641	0.993	cellular nitrogen compound metabolic process
GO:1901576	0.988	organic substance biosynthetic process
GO:0044249	0.986	cellular biosynthetic process
GO:0019538	0.985	protein metabolic process
GO:0044260	0.984	cellular macromolecule metabolic process
GO:0010467	0.982	gene expression
GO:1901566	0.979	organonitrogen compound biosynthetic process
GO:0044271	0.979	cellular nitrogen compound biosynthetic process
GO:0009059	0.975	macromolecule biosynthetic process
GO:0006412	0.973	translation
GO:0006139	0.956	nucleobase-containing compound metabolic process
GO:0006418	0.946	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005829	0.991	cytosol
GO:0032991	0.599	protein-containing complex
GO:0070013	0.542	intracellular organelle lumen
GO:0005634	0.432	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17773	1.000	ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys)
EC:6.1.1.16	1.000	cysteine--tRNA ligase.

[back to server]