StarFunc result for job id P49590

User Input

>input (506 residues)
MPLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTP
KGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKD
QGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIA
GQFDPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAVCGVPESKFRAICSSID
KLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQDPRLSQNKQALEGL
GDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGEEPLNVGSVAA
GGRYDGLVGMFDPKGHKVPCVGLSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKN
FLQERLKLIAELWDSGIKAEMLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIR
SVASREEVAIKRENFVAEIQKRLSES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y5P7	0.900	0.889	2.179E-88	512	0.998	0.986	A0A2R8Y5P7.pdb.gz	A0A2R8Y5P7_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
2	AFDB:Q99KK9	0.903	0.905	1.589E-82	505	0.842	0.844	Q99KK9.pdb.gz	SYHM_MOUSE Histidine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Hars2 PE=1 SV=1
3	AFDB:A0A2R8Y3N3	0.816	0.872	1.431E-79	473	0.935	1.000	A0A2R8Y3N3.pdb.gz	A0A2R8Y3N3_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
4	AFDB:E7ETE2	0.882	0.872	1.872E-73	512	0.719	0.711	E7ETE2.pdb.gz	E7ETE2_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
5	AFDB:E9QI36	0.862	0.850	4.313E-69	513	0.632	0.624	E9QI36.pdb.gz	HARS1_DANRE Histidine--tRNA ligase OS=Danio rerio OX=7955 GN=hars PE=3 SV=2
6	PDB:4phcA	0.846	0.962	2.057E-68	444	0.690	0.786	4phcA.pdb.gz	Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.
7	AFDB:Q8IQX8	0.871	0.782	2.283E-66	564	0.543	0.488	Q8IQX8.pdb.gz	Q8IQX8_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=2
8	PDB:4g85A	0.804	0.947	5.465E-63	427	0.664	0.787	4g85A.pdb.gz
9	PDB:6o76B	0.778	0.870	1.054E-60	451	0.652	0.732	6o76B.pdb.gz
10	AFDB:O43011	0.854	0.769	3.508E-57	563	0.478	0.430	O43011.pdb.gz	SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hts1 PE=1 SV=2
11	AFDB:P34183	0.862	0.838	3.700E-57	521	0.486	0.472	P34183.pdb.gz	SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=hars-1 PE=2 SV=3
12	AFDB:B4DDD8	0.719	0.834	1.235E-55	435	0.609	0.708	B4DDD8.pdb.gz	B4DDD8_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
13	AFDB:P07263	0.855	0.794	3.105E-53	546	0.429	0.397	P07263.pdb.gz	SYH_YEAST Histidine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTS1 PE=1 SV=2
14	PDB:4x5oB	0.672	0.965	2.524E-49	350	0.549	0.794	4x5oB.pdb.gz
15	PDB:3hriA	0.651	0.809	5.770E-26	401	0.192	0.242	3hriA.pdb.gz
16	PDB:1kmmC	0.626	0.801	6.085E-26	387	0.186	0.243	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.
17	PDB:1httA	0.624	0.849	2.031E-24	366	0.176	0.243	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
18	PDB:3hriF	0.621	0.833	6.200E-24	370	0.184	0.251	3hriF.pdb.gz
19	PDB:1qf6A	0.506	0.413	4.858E-16	641	0.128	0.101	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
20	PDB:1nj1A	0.431	0.462	1.537E-14	463	0.123	0.134	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y3N3	0.0	956	473	0.935	1.000	A0A2R8Y3N3_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
2	A0A2R8Y5P7	0.0	1035	512	1.000	0.988	A0A2R8Y5P7_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
3	A0A2R8Y6I1	0.0	895	436	0.862	1.000	A0A2R8Y6I1_HUMAN histidine--tRNA ligase OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
4	B4DDD8	0.0	562	435	0.528	0.614	B4DDD8_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
5	B4E1C5	0.0	563	395	0.528	0.676	B4E1C5_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
6	D6RJE6	0.0	607	293	0.579	1.000	D6RJE6_HUMAN Histidyl-tRNA synthetase 2, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=2
7	E7ETE2	0.0	759	512	0.709	0.701	E7ETE2_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
8	E9QI36	0.0	674	513	0.626	0.618	HARS1_DANRE Histidine--tRNA ligase OS=Danio rerio OX=7955 GN=hars PE=3 SV=2
9	M9PHI2	0.0	573	554	0.528	0.482	M9PHI2_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=1
10	P12081	0.0	764	509	0.709	0.705	HARS1_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
11	P49590	0.0	1041	506	1.000	1.000	SYHM_HUMAN Histidine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1
12	Q8IQX8	0.0	574	564	0.528	0.473	Q8IQX8_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=2
13	Q99KK9	0.0	882	505	0.842	0.844	SYHM_MOUSE Histidine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Hars2 PE=1 SV=1
14	Q9VWT1	0.0	575	522	0.528	0.511	Q9VWT1_DROME histidine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=HisRS PE=1 SV=1
15	P34183	7.01e-166	481	521	0.490	0.476	SYH_CAEEL Histidine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=hars-1 PE=2 SV=3
16	O43011	1.50e-164	479	563	0.470	0.423	SYH_SCHPO Histidine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hts1 PE=1 SV=2
17	P07263	2.40e-144	427	546	0.427	0.396	SYH_YEAST Histidine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTS1 PE=1 SV=2
18	Q550L8	3.67e-46	175	1358	0.255	0.095	IFKB_DICDI Probable serine/threonine-protein kinase ifkB OS=Dictyostelium discoideum OX=44689 GN=ifkB PE=2 SV=1
19	Q558U1	3.22e-45	172	2258	0.255	0.057	IFKA_DICDI Probable serine/threonine-protein kinase ifkA OS=Dictyostelium discoideum OX=44689 GN=ifkA PE=2 SV=1
20	O82413	1.89e-34	137	486	0.247	0.257	SYHM_ARATH Histidine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g46100 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03129 HGTP_anticodon	5.4e-14	63.4	Anticodon binding domain
2	PF12745 HGTP_anticodon2	7.1e-06	37.3	Anticodon binding domain of tRNAs
3	PF13393 tRNA-synt_His	8.8e-36	135.3	Histidyl-tRNA synthetase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230771

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362576	0.962	Tyrosine--tRNA ligase, cytoplasmic
2	9606.ENSP00000355890	0.953	Bifunctional glutamate/proline--tRNA ligase
3	9606.ENSP00000325448	0.946	Lysine--tRNA ligase
4	9606.ENSP00000477572	0.890	Heme oxygenase 2
5	9606.ENSP00000373918	0.887	Glycine--tRNA ligase
6	9606.ENSP00000281038	0.876	Probable asparagine--tRNA ligase, mitochondrial
7	9606.ENSP00000262027	0.867	Methionine--tRNA ligase, cytoplasmic
8	9606.ENSP00000377954	0.855	Leucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000244571	0.840	Alanine--tRNA ligase, mitochondrial
10	9606.ENSP00000261772	0.839	Alanine--tRNA ligase, cytoplasmic
11	9606.ENSP00000425634	0.836	Histidine--tRNA ligase, cytoplasmic
12	9606.ENSP00000358060	0.815	Threonine--tRNA ligase, mitochondrial
13	9606.ENSP00000338093	0.813	Probable threonine--tRNA ligase 2, cytoplasmic
14	9606.ENSP00000256854	0.812	Asparagine--tRNA ligase, cytoplasmic
15	9606.ENSP00000376946	0.809	Bardet-Biedl syndrome 10 protein
16	9606.ENSP00000320658	0.803	Tyrosine--tRNA ligase, mitochondrial
17	9606.ENSP00000256383	0.802	Eukaryotic translation initiation factor 2 subunit 1
18	9606.ENSP00000364794	0.802	Isoleucine--tRNA ligase, cytoplasmic
19	9606.ENSP00000387710	0.798	Threonine--tRNA ligase, cytoplasmic
20	9606.ENSP00000472847	0.797	Serine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004821	0.999	histidine-tRNA ligase activity
GO:0042802	0.997	identical protein binding
GO:0003723	0.997	RNA binding
GO:0043167	0.693	ion binding
GO:0032559	0.678	adenyl ribonucleotide binding
GO:0005524	0.670	ATP binding
GO:0046983	0.642	protein dimerization activity
GO:0042803	0.519	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006418	0.990	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.966	intracellular organelle lumen
GO:0005759	0.312	mitochondrial matrix
GO:0005829	0.302	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17313	0.999	ATP + L-histidine + tRNA(His) = AMP + diphosphate + H(+) + L-histidyl-tRNA(His)
EC:6.1.1.21	0.999	histidine--tRNA ligase.

[back to server]