StarFunc result for job id P49591

User Input

>input (514 residues)
MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAE
RIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQEP
SKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49591	1.000	1.000	3.094E-98	514	1.000	1.000	P49591.pdb.gz	SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3
2	AFDB:Q5T5C7	0.935	0.897	2.746E-93	536	0.998	0.957	Q5T5C7.pdb.gz	Q5T5C7_HUMAN serine--tRNA ligase OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=1
3	PDB:4l87A	0.914	0.986	5.090E-87	476	0.922	0.996	4l87A.pdb.gz	Crystal Structure of Human Seryl-tRNA Synthetase and Ser-SA Complex Reveals a Molecular Lever Specific to Higher Eukaryotes.
4	AFDB:Q6DRC0	0.940	0.938	7.069E-86	515	0.815	0.814	Q6DRC0.pdb.gz	SYSC_DANRE Serine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=sars1 PE=1 SV=1
5	PDB:3vbbB	0.826	0.930	4.182E-76	454	0.881	0.998	3vbbB.pdb.gz
6	AFDB:Q18678	0.924	0.975	2.823E-74	487	0.625	0.659	Q18678.pdb.gz	SYSC_CAEEL Probable serine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=sars-1 PE=3 SV=1
7	AFDB:Q9VQL1	0.912	0.935	1.595E-72	501	0.665	0.683	Q9VQL1.pdb.gz	Q9VQL1_DROME serine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=SerRS PE=1 SV=1
8	AFDB:Q384V4	0.843	0.903	4.989E-59	479	0.461	0.495	Q384V4.pdb.gz	Q384V4_TRYB2 serine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5020 PE=1 SV=1
9	AFDB:Q39230	0.833	0.948	2.938E-56	451	0.444	0.506	Q39230.pdb.gz	SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g27470 PE=1 SV=1
10	AFDB:Q7KWQ2	0.824	0.938	5.352E-56	451	0.461	0.525	Q7KWQ2.pdb.gz	SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=serS PE=1 SV=1
11	PDB:3lssB	0.841	0.920	3.020E-55	468	0.461	0.506	3lssB.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
12	AFDB:P07284	0.826	0.917	1.003E-53	462	0.426	0.474	P07284.pdb.gz	SYSC_YEAST Serine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SES1 PE=1 SV=2
13	AFDB:O14018	0.819	0.934	4.876E-53	450	0.444	0.507	O14018.pdb.gz	SYSC_SCHPO Serine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29A4.15 PE=3 SV=1
14	PDB:3lssA	0.813	0.950	1.684E-52	438	0.453	0.532	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
15	PDB:6girA	0.740	0.930	9.421E-46	406	0.401	0.507	6girA.pdb.gz
16	PDB:6r1mB	0.775	0.925	2.065E-34	428	0.294	0.353	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
17	PDB:1wleB	0.728	0.793	5.217E-34	469	0.232	0.254	1wleB.pdb.gz	Dual-mode recognition of noncanonical tRNAs(Ser) by seryl-tRNA synthetase in mammalian mitochondria
18	PDB:7u2aB	0.678	0.783	3.073E-31	442	0.218	0.253	7u2aB.pdb.gz	Structural basis for shape-selective recognition and aminoacylation of a D-armless human mitochondrial tRNA.
19	PDB:1serB	0.725	0.880	3.245E-31	421	0.235	0.287	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
20	PDB:1nj1A	0.480	0.531	2.639E-15	463	0.099	0.110	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P26638	0.0	1021	512	0.955	0.959	SYSC_MOUSE Serine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Sars1 PE=1 SV=3
2	P49591	0.0	1068	514	1.000	1.000	SYSC_HUMAN Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3
3	Q18678	0.0	683	487	0.625	0.659	SYSC_CAEEL Probable serine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=sars-1 PE=3 SV=1
4	Q5T5C7	0.0	1057	536	1.000	0.959	Q5T5C7_HUMAN serine--tRNA ligase OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=1
5	Q6DRC0	0.0	853	515	0.804	0.802	SYSC_DANRE Serine--tRNA ligase, cytoplasmic OS=Danio rerio OX=7955 GN=sars1 PE=1 SV=1
6	Q9VQL1	0.0	708	501	0.660	0.677	Q9VQL1_DROME serine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=SerRS PE=1 SV=1
7	Q7KWQ2	1.79e-159	462	451	0.475	0.541	SYSC_DICDI Serine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=serS PE=1 SV=1
8	Q384V4	1.39e-155	454	479	0.457	0.491	Q384V4_TRYB2 serine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5020 PE=1 SV=1
9	Q39230	5.67e-155	451	451	0.461	0.525	SYSC_ARATH Serine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g27470 PE=1 SV=1
10	Q95TC0	1.58e-148	427	272	0.389	0.735	Q95TC0_DROME serine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=SerRS PE=2 SV=1
11	O14018	6.02e-146	428	450	0.469	0.536	SYSC_SCHPO Serine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29A4.15 PE=3 SV=1
12	P07284	1.78e-138	409	462	0.447	0.498	SYSC_YEAST Serine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SES1 PE=1 SV=2
13	P9WFT7	1.88e-67	225	419	0.304	0.372	SYS_MYCTU Serine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serS PE=1 SV=1
14	Q8RWT8	6.53e-63	215	514	0.249	0.249	SYSM_ARATH Serine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA7 PE=2 SV=1
15	O51244	9.78e-61	207	425	0.263	0.318	SYS_BORBU Serine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=serS PE=3 SV=1
16	P0A8L1	2.90e-60	206	430	0.280	0.335	SYS_ECOLI Serine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=serS PE=1 SV=1
17	P34945	7.12e-54	189	421	0.198	0.242	SYS_THET2 Serine--tRNA ligase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=serS PE=1 SV=2
18	P38705	9.13e-51	181	446	0.257	0.296	SYSM_YEAST Serine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DIA4 PE=1 SV=1
19	Q9N0F3	2.49e-49	179	518	0.200	0.199	SYSM_BOVIN Serine--tRNA ligase, mitochondrial OS=Bos taurus OX=9913 GN=SARS2 PE=1 SV=1
20	Q9NP81	1.78e-48	177	518	0.196	0.195	SYSM_HUMAN Serine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=SARS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06816 NOD	2.4e+02	12.5	NOTCH protein
2	PF02403 Seryl_tRNA_N	2.8e-15	67.8	Seryl-tRNA synthetase N-terminal domain
3	PF00587 tRNA-synt_2b	6.4e-45	164.8	tRNA synthetase class II core domain (G, H, P, S and T)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357882	0.993	L-seryl-tRNA(Sec) kinase
2	9606.ENSP00000362576	0.977	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000261772	0.975	Alanine--tRNA ligase, cytoplasmic
4	9606.ENSP00000387710	0.974	Threonine--tRNA ligase, cytoplasmic
5	9606.ENSP00000373918	0.970	Glycine--tRNA ligase
6	9606.ENSP00000369897	0.962	Cysteine--tRNA ligase, cytoplasmic
7	9606.ENSP00000262027	0.959	Methionine--tRNA ligase, cytoplasmic
8	9606.ENSP00000338093	0.950	Probable threonine--tRNA ligase 2, cytoplasmic
9	9606.ENSP00000377954	0.946	Leucine--tRNA ligase, cytoplasmic
10	9606.ENSP00000408576	0.925	Probable leucine--tRNA ligase, mitochondrial
11	9606.ENSP00000355890	0.920	Bifunctional glutamate/proline--tRNA ligase
12	9606.ENSP00000256854	0.915	Asparagine--tRNA ligase, cytoplasmic
13	9606.ENSP00000364794	0.913	Isoleucine--tRNA ligase, cytoplasmic
14	9606.ENSP00000320658	0.912	Tyrosine--tRNA ligase, mitochondrial
15	9606.ENSP00000358549	0.912	Probable arginine--tRNA ligase, mitochondrial
16	9606.ENSP00000371535	0.912	O-phosphoseryl-tRNA(Sec) selenium transferase
17	9606.ENSP00000347495	0.906	Tryptophan--tRNA ligase, cytoplasmic
18	9606.ENSP00000360327	0.900	Probable proline--tRNA ligase, mitochondrial
19	9606.ENSP00000307567	0.890	Glutamine--tRNA ligase
20	9606.ENSP00000257347	0.867	Probable cysteine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004828	0.997	serine-tRNA ligase activity
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0005515	0.972	protein binding
GO:0003676	0.927	nucleic acid binding
GO:0042802	0.746	identical protein binding
GO:0043167	0.369	ion binding
GO:0003723	0.348	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006412	0.989	translation
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0006418	0.977	tRNA aminoacylation for protein translation
GO:0065007	0.615	biological regulation
GO:0050789	0.607	regulation of biological process
GO:0019222	0.515	regulation of metabolic process
GO:0060255	0.507	regulation of macromolecule metabolic process
GO:0050794	0.457	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.991	intracellular organelle
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005829	0.979	cytosol
GO:0005739	0.745	mitochondrion
GO:0005634	0.724	nucleus
GO:0070013	0.552	intracellular organelle lumen
GO:0065010	0.472	extracellular membrane-bounded organelle
GO:1903561	0.456	extracellular vesicle
GO:0070062	0.348	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12292	0.997	ATP + L-serine + tRNA(Ser) = AMP + diphosphate + H(+) + L-seryl-tRNA(Ser)
EC:6.1.1.11	0.997	serine--tRNA ligase.

[back to server]