StarFunc result for job id P49593

User Input

>input (454 residues)
MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAE
LAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLL
DAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFN
QLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQ
MFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVVKLMEPHRPERQDEK
ARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACD
GFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELL
EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49593	1.000	1.000	6.329E-87	454	1.000	1.000	P49593.pdb.gz	PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F PE=1 SV=3
2	AFDB:Q9WVR7	0.908	0.916	4.443E-73	450	0.791	0.798	Q9WVR7.pdb.gz	PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus OX=10116 GN=Ppm1f PE=2 SV=1
3	AFDB:A2BE49	0.866	0.926	2.545E-52	424	0.476	0.509	A2BE49.pdb.gz	A2BE49_DANRE Protein phosphatase 1F OS=Danio rerio OX=7955 GN=CaMKP PE=1 SV=1
4	AFDB:B3DGT0	0.841	0.609	2.475E-50	633	0.452	0.324	B3DGT0.pdb.gz
5	AFDB:Q8WY54	0.791	0.483	9.742E-49	755	0.449	0.270	Q8WY54.pdb.gz	PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens OX=9606 GN=PPM1E PE=1 SV=3
6	AFDB:P49594	0.666	0.673	2.946E-28	449	0.218	0.220	P49594.pdb.gz	FEM2_CAEEL Protein phosphatase fem-2 OS=Caenorhabditis elegans OX=6239 GN=fem-2 PE=1 SV=2
7	PDB:4jndA	0.647	0.712	2.634E-26	408	0.214	0.238	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
8	AFDB:Q94AT1	0.511	0.552	1.144E-25	420	0.222	0.240	Q94AT1.pdb.gz	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
9	AFDB:Q8LAY8	0.522	0.665	2.284E-25	354	0.196	0.251	Q8LAY8.pdb.gz	P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1
10	AFDB:P93006	0.540	0.643	4.102E-25	380	0.205	0.245	P93006.pdb.gz	P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana OX=3702 GN=PP2C27 PE=2 SV=1
11	AFDB:Q6EN45	0.524	0.652	1.128E-24	363	0.200	0.251	Q6EN45.pdb.gz	P2C13_ORYSJ Probable protein phosphatase 2C member 13, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C13 PE=2 SV=1
12	PDB:4oicB	0.507	0.743	4.137E-24	305	0.196	0.292	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
13	PDB:1a6qA	0.523	0.649	1.213E-20	363	0.172	0.215	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
14	PDB:7kprA	0.448	0.501	2.353E-14	403	0.154	0.174	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
15	PDB:6jkvA	0.411	0.769	6.048E-13	230	0.119	0.235	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
16	PDB:5d2uA	0.407	0.742	1.274E-12	240	0.128	0.242	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
17	PDB:5nzzD	0.459	0.544	1.951E-12	379	0.132	0.158	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
18	PDB:2pk0A	0.437	0.763	4.571E-12	247	0.119	0.219	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
19	PDB:3w40A	0.329	0.686	1.395E-7	199	0.084	0.191	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.273	0.287	2.370E-3	427	0.062	0.066	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49593	0.0	920	454	1.000	1.000	PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens OX=9606 GN=PPM1F PE=1 SV=3
2	Q6IPC0	0.0	913	453	0.998	1.000	Q6IPC0_HUMAN Protein phosphatase 1F (PP2C domain containing) OS=Homo sapiens OX=9606 GN=PPM1F PE=1 SV=1
3	Q9WVR7	0.0	672	450	0.791	0.798	PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus OX=10116 GN=Ppm1f PE=2 SV=1
4	A2BE49	3.88e-140	410	424	0.476	0.509	A2BE49_DANRE Protein phosphatase 1F OS=Danio rerio OX=7955 GN=CaMKP PE=1 SV=1
5	Q53VM5	3.59e-124	376	633	0.436	0.313	Q53VM5_DANRE Ca/calmodulin-dependent protein kinase phosphatase-N OS=Danio rerio OX=7955 GN=ppm1e PE=1 SV=1
6	Q80Z30	1.19e-123	379	750	0.430	0.260	PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus OX=10116 GN=Ppm1e PE=1 SV=1
7	Q80TL0	2.97e-123	377	749	0.430	0.260	PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus OX=10090 GN=Ppm1e PE=1 SV=2
8	Q8WY54	5.00e-123	377	755	0.427	0.257	PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens OX=9606 GN=PPM1E PE=1 SV=3
9	Q8RXV3	2.91e-45	161	311	0.187	0.273	P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana OX=3702 GN=WIN2 PE=1 SV=1
10	Q94AT1	8.30e-44	160	420	0.211	0.229	P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana OX=3702 GN=At5g53140 PE=2 SV=1
11	Q6EN45	1.17e-40	150	363	0.209	0.262	P2C13_ORYSJ Probable protein phosphatase 2C member 13, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C13 PE=2 SV=1
12	Q8LAY8	1.31e-40	150	354	0.174	0.223	P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1
13	Q4PSE8	6.23e-40	150	447	0.181	0.183	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1
14	Q9XEE8	1.12e-39	149	390	0.205	0.238	P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana OX=3702 GN=PP2C5 PE=2 SV=1
15	Q54PX6	4.80e-37	142	403	0.205	0.231	Q54PX6_DICDI Protein phosphatase 2C-related protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284243 PE=3 SV=1
16	Q9SLA1	9.23e-36	138	392	0.200	0.232	P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana OX=3702 GN=At2g25620 PE=1 SV=1
17	O80871	4.79e-35	136	396	0.198	0.227	P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana OX=3702 GN=At2g30020 PE=1 SV=1
18	Q8L7I4	8.44e-35	133	283	0.194	0.311	P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana OX=3702 GN=At1g78200 PE=2 SV=1
19	Q4WTH5	3.97e-34	134	429	0.222	0.235	Q4WTH5_ASPFU Protein phosphatase 2C, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G09280 PE=3 SV=1
20	Q9H0C8	1.35e-33	132	392	0.209	0.242	ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02888 CaMBD	3.4e+02	12.6	Calmodulin binding domain
2	PF00481 PP2C	3.8e-70	248.0	Protein phosphatase 2C
3	PF13672 PP2C_2	0.0019	29.4	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263212

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381412	0.953	Calcium/calmodulin-dependent protein kinase type II subunit alpha
2	9606.ENSP00000319060	0.928	Calcium/calmodulin-dependent protein kinase type II subunit gamma
3	9606.ENSP00000256460	0.917	Calcium/calmodulin-dependent protein kinase type 1
4	9606.ENSP00000339740	0.917	Calcium/calmodulin-dependent protein kinase type II subunit delta
5	9606.ENSP00000307298	0.909	Protein fem-1 homolog B
6	9606.ENSP00000379098	0.908	Calcium/calmodulin-dependent protein kinase type II subunit beta
7	9606.ENSP00000269856	0.851	Protein fem-1 homolog A
8	9606.ENSP00000444856	0.834	Cullin-2
9	9606.ENSP00000274457	0.826	Protein fem-1 homolog C
10	9606.ENSP00000326411	0.731	CWF19-like protein 1
11	9606.ENSP00000380877	0.722	Activating signal cointegrator 1 complex subunit 2
12	9606.ENSP00000366557	0.702	Crooked neck-like protein 1
13	9606.ENSP00000415436	0.702	KAT8 regulatory NSL complex subunit 2
14	9606.ENSP00000346255	0.692	Protein phosphatase which positively regulates biosynthesis of the ubiquinone, coenzyme Q . Dephosphorylates the ubiquinone biosynthesis protein COQ7 which is likely to lead to its activation
15	9606.ENSP00000295910	0.689	Glutamate-rich protein 6
16	9606.ENSP00000286175	0.688	Peptidyl-prolyl cis-trans isomerase
17	9606.ENSP00000364893	0.682	Rho guanine nucleotide exchange factor 7
18	9606.ENSP00000262419	0.679	KAT8 regulatory NSL complex subunit 1
19	9606.ENSP00000258201	0.678	FH1/FH2 domain-containing protein 1
20	9606.ENSP00000317468	0.677	Charged multivesicular body protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0004723	0.990	calcium-dependent protein serine/threonine phosphatase activity
GO:0008138	0.889	protein tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0006796	0.993	phosphate-containing compound metabolic process
GO:0050789	0.991	regulation of biological process
GO:0036211	0.988	protein modification process
GO:0006470	0.979	protein dephosphorylation
GO:0019222	0.965	regulation of metabolic process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0080090	0.958	regulation of primary metabolic process
GO:0048518	0.931	positive regulation of biological process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0050794	0.912	regulation of cellular process
GO:0065009	0.789	regulation of molecular function
GO:0051246	0.757	regulation of protein metabolic process
GO:0044093	0.737	positive regulation of molecular function
GO:0050790	0.736	regulation of catalytic activity
GO:0051247	0.736	positive regulation of protein metabolic process
GO:0043085	0.559	positive regulation of catalytic activity
GO:0052548	0.511	regulation of endopeptidase activity
GO:0051345	0.498	positive regulation of hydrolase activity
GO:0045862	0.484	positive regulation of proteolysis
GO:0043281	0.470	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048522	0.459	positive regulation of cellular process
GO:0031323	0.446	regulation of cellular metabolic process
GO:0010950	0.429	positive regulation of endopeptidase activity
GO:2001056	0.415	positive regulation of cysteine-type endopeptidase activity
GO:0050896	0.412	response to stimulus
GO:0048519	0.367	negative regulation of biological process
GO:0048523	0.321	negative regulation of cellular process
GO:0051716	0.301	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.993	protein-containing complex
GO:0005634	0.840	nucleus
GO:0031981	0.381	nuclear lumen
GO:0005654	0.323	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.

[back to server]