StarFunc result for job id P49639

User Input

>input (335 residues)
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ
IGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVS
GGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSL
SPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQ
LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP
PGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49639	1.000	1.000	1.073E-44	335	1.000	1.000	P49639.pdb.gz	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
2	AFDB:Q9GZZ0	0.279	0.285	6.549E-14	328	0.346	0.354	Q9GZZ0.pdb.gz	HXD1_HUMAN Homeobox protein Hox-D1 OS=Homo sapiens OX=9606 GN=HOXD1 PE=2 SV=1
3	AFDB:Q01822	0.272	0.277	9.123E-14	328	0.361	0.369	Q01822.pdb.gz	HXD1_MOUSE Homeobox protein Hox-D1 OS=Mus musculus OX=10090 GN=Hoxd1 PE=2 SV=2
4	AFDB:A5PLE8	0.223	0.290	5.504E-9	255	0.224	0.294	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
5	AFDB:P09630	0.208	0.295	1.940E-8	235	0.203	0.289	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
6	AFDB:P31267	0.228	0.315	2.888E-8	233	0.245	0.352	P31267.pdb.gz	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
7	AFDB:A8KBT9	0.201	0.246	5.606E-8	270	0.200	0.248	A8KBT9.pdb.gz	A8KBT9_DANRE Caudal type homeo box transcription factor 4 OS=Danio rerio OX=7955 GN=CHUNP6923 PE=2 SV=1
8	AFDB:P09085	0.206	0.166	7.810E-8	427	0.236	0.185	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
9	AFDB:Q04787	0.189	0.150	1.731E-7	429	0.224	0.175	Q04787.pdb.gz	BSH_DROME Brain-specific homeobox protein OS=Drosophila melanogaster OX=7227 GN=bsh PE=2 SV=5
10	AFDB:Q98877	0.185	0.248	1.731E-7	247	0.182	0.247	Q98877.pdb.gz	DLX6A_DANRE Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1
11	PDB:4egcA	0.148	0.092	8.061E-3	539	0.048	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.157	0.617	2.659E-2	73	0.060	0.274	2hi3A.pdb.gz
13	PDB:5nr5A	0.115	0.308	5.256E-1	113	0.030	0.088	5nr5A.pdb.gz
14	PDB:5aj0BZ	0.121	0.402	6.413E-1	86	0.036	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:7fbyA	0.116	0.230	6.413E-1	153	0.033	0.072	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:5mrca	0.129	0.217	1.519	177	0.042	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:5gadi	0.146	0.113	1.623	450	0.051	0.038	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
18	PDB:7b93E	0.085	0.126	1.853	215	0.030	0.047	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
19	PDB:2cg4A	0.115	0.233	2.261	149	0.024	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:6dv9F	0.097	0.176	2.948	174	0.036	0.069	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09022	0.0	568	331	0.848	0.858	HXA1_MOUSE Homeobox protein Hox-A1 OS=Mus musculus OX=10090 GN=Hoxa1 PE=1 SV=2
2	P49639	0.0	695	335	1.000	1.000	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
3	P17919	7.12e-60	196	297	0.448	0.505	HXB1_MOUSE Homeobox protein Hox-B1 OS=Mus musculus OX=10090 GN=Hoxb1 PE=2 SV=1
4	O42366	3.40e-58	192	311	0.424	0.457	HXB1A_DANRE Homeobox protein Hox-B1a OS=Danio rerio OX=7955 GN=hoxb1a PE=2 SV=2
5	P14653	2.13e-57	189	301	0.415	0.462	HXB1_HUMAN Homeobox protein Hox-B1 OS=Homo sapiens OX=9606 GN=HOXB1 PE=1 SV=2
6	Q08820	2.38e-54	181	300	0.403	0.450	HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis OX=8355 GN=hoxd1 PE=2 SV=3
7	A3KNJ6	1.33e-52	177	307	0.239	0.261	A3KNJ6_DANRE Homeo box B1b OS=Danio rerio OX=7955 GN=cb249 PE=2 SV=1
8	Q90423	1.33e-52	177	307	0.239	0.261	HXB1B_DANRE Homeobox protein Hox-B1b OS=Danio rerio OX=7955 GN=hoxb1b PE=2 SV=3
9	Q01822	8.60e-50	171	328	0.245	0.250	HXD1_MOUSE Homeobox protein Hox-D1 OS=Mus musculus OX=10090 GN=Hoxd1 PE=2 SV=2
10	Q9GZZ0	8.13e-46	160	328	0.230	0.235	HXD1_HUMAN Homeobox protein Hox-D1 OS=Homo sapiens OX=9606 GN=HOXD1 PE=2 SV=1
11	P10105	9.05e-32	127	635	0.164	0.087	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
12	P10628	4.64e-23	98.2	250	0.152	0.204	HXD4_MOUSE Homeobox protein Hox-D4 OS=Mus musculus OX=10090 GN=Hoxd4 PE=1 SV=3
13	P09016	3.09e-22	95.9	255	0.161	0.212	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
14	P14652	6.81e-22	97.1	356	0.179	0.169	HXB2_HUMAN Homeobox protein Hox-B2 OS=Homo sapiens OX=9606 GN=HOXB2 PE=1 SV=1
15	P31264	8.96e-22	98.6	782	0.143	0.061	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
16	P31249	1.36e-21	97.1	432	0.155	0.120	HXD3_HUMAN Homeobox protein Hox-D3 OS=Homo sapiens OX=9606 GN=HOXD3 PE=1 SV=3
17	O57374	1.86e-21	93.6	236	0.146	0.208	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
18	Q86TF7	2.15e-21	94.0	264	0.155	0.197	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1
19	H0YHX3	2.54e-21	90.5	140	0.122	0.293	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
20	P02831	2.60e-21	96.3	443	0.170	0.129	HXA3_MOUSE Homeobox protein Hox-A3 OS=Mus musculus OX=10090 GN=Hoxa3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.7e-18	77.5	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405890	0.881	Pre-B-cell leukemia transcription factor 1
2	9606.ENSP00000364190	0.840	Pre-B-cell leukemia transcription factor 2
3	9606.ENSP00000355140	0.825	Homeobox protein Hox-B1
4	9606.ENSP00000328598	0.821	Homeobox protein Hox-D1
5	9606.ENSP00000362588	0.790	Pre-B-cell leukemia transcription factor 3
6	9606.ENSP00000386741	0.767	N-chimaerin
7	9606.ENSP00000380903	0.725	Roundabout homolog 3
8	9606.ENSP00000217086	0.687	Sal-like protein 4
9	9606.ENSP00000353203	0.653	Late cornified envelope protein 1B
10	9606.ENSP00000299529	0.649	Cellular retinoic acid-binding protein 1
11	9606.ENSP00000303942	0.607	Platelet glycoprotein IX
12	9606.ENSP00000481675	0.589	Protein sprouty homolog 1
13	9606.ENSP00000291547	0.555	Homeobox protein PKNOX1
14	9606.ENSP00000310998	0.525	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
15	9606.ENSP00000382090	0.507	Claudin-14
16	9606.ENSP00000222718	0.501	Homeobox protein Hox-A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.930	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.908	identical protein binding
GO:0000976	0.518	transcription cis-regulatory region binding
GO:0000977	0.431	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.985	developmental process
GO:0050794	0.985	regulation of cellular process
GO:0048856	0.982	anatomical structure development
GO:0032501	0.978	multicellular organismal process
GO:0010604	0.940	positive regulation of macromolecule metabolic process
GO:0007275	0.924	multicellular organism development
GO:0048522	0.905	positive regulation of cellular process
GO:0031323	0.895	regulation of cellular metabolic process
GO:0006355	0.890	regulation of DNA-templated transcription
GO:0031325	0.889	positive regulation of cellular metabolic process
GO:0045893	0.871	positive regulation of DNA-templated transcription
GO:0006357	0.833	regulation of transcription by RNA polymerase II
GO:0009987	0.777	cellular process
GO:0048513	0.744	animal organ development
GO:0045944	0.667	positive regulation of transcription by RNA polymerase II
GO:0060322	0.661	head development
GO:0021675	0.640	nerve development
GO:0009653	0.542	anatomical structure morphogenesis
GO:0021545	0.507	cranial nerve development
GO:0009790	0.401	embryo development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.612	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]