StarFunc result for job id P49641

User Input

>input (1150 residues)
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSISPQDCQFAL
GGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHAR
RSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVII
HAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSSPRFVVLFNPLEQER
FSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLPALGLGVLQL
QLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDFALSNRYMQVWFSGLTGL
LKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPF
FSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTDIDSQGIFFT
DLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDAQKRLTLHTAQALGVSSLKDGQLEVIL
DRRLMQDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSMYLN
APALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKG
FDCGLEAKNLGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPM
EIATFRLRLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3bubA	0.817	0.923	0.000	1016	0.362	0.409	3bubA.pdb.gz	Probing the substrate specificity of Golgi alpha-mannosidase II by use of synthetic oligosaccharides and a catalytic nucleophile mutant.
2	PDB:6rrnA	0.806	0.934	0.000	989	0.360	0.419	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
3	AFDB:O18497	0.820	0.834	0.000	1130	0.311	0.317	O18497.pdb.gz	MAN2_SPOFR Alpha-mannosidase 2 OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
4	AFDB:O97043	0.818	0.754	0.000	1249	0.345	0.318	O97043.pdb.gz	O97043_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
5	AFDB:P27046	0.891	0.891	0.000	1150	0.538	0.538	P27046.pdb.gz	MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2
6	AFDB:P49641	1.000	1.000	0.000	1150	1.000	1.000	P49641.pdb.gz	MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3
7	AFDB:Q16706	0.896	0.900	0.000	1144	0.537	0.540	Q16706.pdb.gz	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2
8	AFDB:Q24451	0.820	0.851	0.000	1108	0.388	0.403	Q24451.pdb.gz	MAN2_DROME Alpha-mannosidase 2 OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIa PE=1 SV=2
9	AFDB:Q2PJ74	0.815	0.818	0.000	1145	0.361	0.362	Q2PJ74.pdb.gz	Q2PJ74_CAEEL Alpha-mannosidase OS=Caenorhabditis elegans OX=6239 GN=aman-2 PE=1 SV=1
10	AFDB:Q8BRK9	0.937	0.935	0.000	1152	0.897	0.895	Q8BRK9.pdb.gz	MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2
11	AFDB:Q9LFR0	0.849	0.833	0.000	1173	0.388	0.380	Q9LFR0.pdb.gz	GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
12	AFDB:P34098	0.705	0.799	1.319E-78	1010	0.211	0.241	P34098.pdb.gz	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
13	PDB:7vqoA	0.541	0.528	1.063E-36	1180	0.144	0.141	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
14	PDB:7dd9A	0.541	0.550	7.444E-36	1129	0.146	0.149	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
15	PDB:5jm0A	0.499	0.598	1.435E-25	940	0.127	0.155	5jm0A.pdb.gz
16	PDB:3p0bA	0.234	0.458	1.437E-8	511	0.061	0.137	3p0bA.pdb.gz
17	PDB:6drvA	0.111	0.123	3.459E-5	1024	0.043	0.048	6drvA.pdb.gz
18	PDB:3nreA	0.123	0.378	1.020E-4	291	0.029	0.113	3nreA.pdb.gz
19	PDB:6al2A	0.126	0.267	3.007E-4	484	0.022	0.052	6al2A.pdb.gz
20	PDB:5mg3C	0.130	0.290	1.791E-3	455	0.019	0.048	5mg3C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18497	0.0	578	1130	0.303	0.308	MAN2_SPOFR Alpha-mannosidase 2 OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
2	O97043	0.0	592	1249	0.340	0.313	O97043_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
3	P27046	0.0	1284	1150	0.543	0.543	MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2
4	P28494	0.0	1261	1148	0.535	0.536	MA2A1_RAT Alpha-mannosidase 2 OS=Rattus norvegicus OX=10116 GN=Man2a1 PE=1 SV=2
5	P49641	0.0	2378	1150	1.000	1.000	MA2A2_HUMAN Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3
6	Q16706	0.0	1276	1144	0.542	0.545	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2
7	Q24451	0.0	755	1108	0.395	0.410	MAN2_DROME Alpha-mannosidase 2 OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIa PE=1 SV=2
8	Q2PJ74	0.0	732	1145	0.359	0.361	Q2PJ74_CAEEL Alpha-mannosidase OS=Caenorhabditis elegans OX=6239 GN=aman-2 PE=1 SV=1
9	Q75WP2	0.0	590	1249	0.337	0.310	Q75WP2_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
10	Q8BRK9	0.0	2130	1152	0.898	0.897	MA2A2_MOUSE Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2
11	Q9LFR0	0.0	775	1173	0.383	0.375	GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
12	Q9VF33	0.0	595	1249	0.341	0.314	Q9VF33_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=2
13	Q8MSX9	3.08e-149	473	935	0.250	0.308	Q8MSX9_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIb PE=2 SV=1
14	P94078	5.69e-87	306	1019	0.243	0.275	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
15	Q8LPJ3	9.57e-85	300	1024	0.222	0.249	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
16	O09159	9.77e-82	291	1013	0.252	0.286	MA2B1_MOUSE Lysosomal alpha-mannosidase OS=Mus musculus OX=10090 GN=Man2b1 PE=1 SV=4
17	O00754	1.15e-81	290	1011	0.251	0.286	MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3
18	Q9VKV1	4.62e-81	290	1080	0.214	0.228	Q9VKV1_DROME Alpha-mannosidase OS=Drosophila melanogaster OX=7227 GN=LManII PE=1 SV=2
19	Q6P762	1.87e-80	287	1009	0.244	0.278	Q6P762_RAT Alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man2b1 PE=2 SV=1
20	Q29451	3.52e-79	283	999	0.246	0.283	MA2B1_BOVIN Lysosomal alpha-mannosidase OS=Bos taurus OX=9913 GN=MAN2B1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09261 Alpha-mann_mid	2.1e-19	80.8	Alpha mannosidase middle domain
2	PF10073 DUF2312	7.5e+02	11.1	Uncharacterized protein conserved in bacteria (DUF2312)
3	PF17677 Glyco_hydro38C2	80	14.8	Glycosyl hydrolases family 38 C-terminal beta sandwich domain
4	PF07748 Glyco_hydro_38C	6.8e-40	149.0	Glycosyl hydrolases family 38 C-terminal domain
5	PF01074 Glyco_hydro_38N	1.5e-103	357.8	Glycosyl hydrolases family 38 N-terminal domain
6	PF03065 Glyco_hydro_57	4.8e+02	11.3	Glycosyl hydrolase family 57

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452948

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363452	0.982	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
2	9606.ENSP00000404718	0.981	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
3	9606.ENSP00000353910	0.979	Alpha-(1,6)-fucosyltransferase
4	9606.ENSP00000348959	0.962	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
5	9606.ENSP00000307423	0.961	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
6	9606.ENSP00000357453	0.959	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
7	9606.ENSP00000306496	0.901	Ras-related protein Rab-33B
8	9606.ENSP00000417354	0.900	Golgi integral membrane protein 4
9	9606.ENSP00000261483	0.808	Alpha-mannosidase 2
10	9606.ENSP00000256497	0.701	ER degradation-enhancing alpha-mannosidase-like protein 1
11	9606.ENSP00000353401	0.692	Homeobox protein cut-like 1
12	9606.ENSP00000324628	0.670	Gamma-soluble NSF attachment protein
13	9606.ENSP00000225724	0.665	Golgi SNAP receptor complex member 1
14	9606.ENSP00000457788	0.657	Alpha-mannosidase 2C1
15	9606.ENSP00000381293	0.656	Vesicle-fusing ATPase
16	9606.ENSP00000163416	0.652	Golgin subfamily A member 5
17	9606.ENSP00000226578	0.651	Beta-mannosidase
18	9606.ENSP00000263354	0.650	Alpha-soluble NSF attachment protein
19	9606.ENSP00000482826	0.650	Beta-soluble NSF attachment protein
20	9606.ENSP00000338487	0.648	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004559	1.000	alpha-mannosidase activity
GO:0016799	0.993	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0015924	0.941	mannosyl-oligosaccharide mannosidase activity
GO:0005488	0.667	binding
GO:0005515	0.430	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:1901135	0.989	carbohydrate derivative metabolic process
GO:0044260	0.983	cellular macromolecule metabolic process
GO:0019538	0.983	protein metabolic process
GO:0009100	0.972	glycoprotein metabolic process
GO:0036211	0.904	protein modification process
GO:1901576	0.630	organic substance biosynthetic process
GO:0009059	0.614	macromolecule biosynthetic process
GO:0044249	0.507	cellular biosynthetic process
GO:1901566	0.461	organonitrogen compound biosynthetic process
GO:1901137	0.431	carbohydrate derivative biosynthetic process
GO:0034645	0.404	cellular macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.998	Golgi membrane
GO:0065010	0.673	extracellular membrane-bounded organelle
GO:0070013	0.660	intracellular organelle lumen
GO:0031982	0.642	vesicle
GO:0070062	0.413	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.24	1.000	alpha-mannosidase.
EC:3.2.2.-	0.993	Hydrolyzing N-glycosyl compounds.
EC:3.2.1.-	0.941	Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.

[back to server]