StarFunc result for job id P49662

User Input

>input (377 residues)
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49662	1.000	1.000	3.158E-78	377	1.000	1.000	P49662.pdb.gz	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
2	AFDB:O75601	0.722	0.722	1.897E-61	377	0.756	0.756	O75601.pdb.gz	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
3	AFDB:P51878	0.724	0.630	1.819E-59	434	0.732	0.636	P51878.pdb.gz	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
4	AFDB:P70343	0.677	0.683	9.841E-53	373	0.594	0.601	P70343.pdb.gz	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
5	AFDB:E9PSM0	0.684	0.723	4.232E-50	356	0.536	0.567	E9PSM0.pdb.gz	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
6	AFDB:Q920D5	0.715	0.643	2.289E-49	420	0.525	0.471	Q920D5.pdb.gz	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
7	AFDB:O08736	0.706	0.636	2.062E-47	419	0.531	0.477	O08736.pdb.gz	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
8	AFDB:P29466	0.665	0.623	1.093E-42	404	0.509	0.475	P29466.pdb.gz	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
9	AFDB:P43527	0.659	0.619	2.173E-42	402	0.451	0.423	P43527.pdb.gz	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
10	AFDB:Q6UXS9	0.618	0.681	2.790E-42	341	0.469	0.519	Q6UXS9.pdb.gz	CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens OX=9606 GN=CASP12 PE=2 SV=3
11	PDB:4pryA	0.552	0.825	5.951E-20	249	0.188	0.285	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
12	PDB:4fdlB	0.543	0.850	3.647E-19	239	0.154	0.243	4fdlB.pdb.gz
13	PDB:4nblA	0.533	0.769	2.931E-16	258	0.170	0.248	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
14	PDB:4iyrB	0.437	0.833	3.024E-13	191	0.149	0.293	4iyrB.pdb.gz
15	PDB:2wdpD	0.475	0.754	4.400E-13	230	0.172	0.283	2wdpD.pdb.gz
16	PDB:7wzsB	0.479	0.857	1.370E-11	206	0.130	0.238	7wzsB.pdb.gz
17	PDB:4af8A	0.372	0.413	5.771E-5	333	0.122	0.138	4af8A.pdb.gz
18	PDB:5wbjA	0.287	0.117	1.778E-4	1058	0.093	0.033	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
19	PDB:6w8rA	0.368	0.380	7.971E-4	364	0.088	0.091	6w8rA.pdb.gz
20	PDB:2fzvB	0.185	0.252	7.109E-3	247	0.050	0.077	2fzvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75601	0.0	584	377	0.756	0.756	CASPD_BOVIN Caspase-13 OS=Bos taurus OX=9913 GN=CASP13 PE=1 SV=1
2	P49662	0.0	791	377	1.000	1.000	CASP4_HUMAN Caspase-4 OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
3	P51878	0.0	575	434	0.732	0.636	CASP5_HUMAN Caspase-5 OS=Homo sapiens OX=9606 GN=CASP5 PE=1 SV=3
4	Q3MHS1	3.05e-158	451	373	0.592	0.598	Q3MHS1_RAT Caspase 4, apoptosis-related cysteine peptidase OS=Rattus norvegicus OX=10116 GN=Casp4 PE=2 SV=1
5	E9PSM0	6.86e-158	451	400	0.592	0.557	E9PSM0_RAT Caspase 4 OS=Rattus norvegicus OX=10116 GN=Casp4 PE=3 SV=4
6	P70343	2.40e-157	449	373	0.597	0.603	CASP4_MOUSE Caspase-4 OS=Mus musculus OX=10090 GN=Casp4 PE=1 SV=2
7	O08736	5.42e-130	381	419	0.546	0.492	CASPC_MOUSE Caspase-12 OS=Mus musculus OX=10090 GN=Casp12 PE=1 SV=1
8	P29466	3.51e-127	373	404	0.525	0.490	CASP1_HUMAN Caspase-1 OS=Homo sapiens OX=9606 GN=CASP1 PE=1 SV=1
9	Q920D5	1.25e-126	372	420	0.538	0.483	CASPC_RAT Caspase-12 OS=Rattus norvegicus OX=10116 GN=Casp12 PE=1 SV=1
10	P29452	1.71e-113	338	402	0.491	0.460	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1
11	P43527	3.44e-110	330	402	0.491	0.460	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
12	Q6UXS9	3.05e-109	325	341	0.475	0.525	CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens OX=9606 GN=CASP12 PE=2 SV=3
13	E9PMT1	6.78e-105	306	147	0.390	1.000	E9PMT1_HUMAN Caspase 4 (Fragment) OS=Homo sapiens OX=9606 GN=CASP4 PE=1 SV=1
14	O42284	1.82e-71	226	283	0.318	0.424	O42284_CHICK Caspase-1 OS=Gallus gallus OX=9031 PE=2 SV=1
15	A0A060XPX2	3.35e-56	189	353	0.308	0.329	A0A060XPX2_ONCMY Caspase-1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039688001 PE=3 SV=1
16	Q9I9L7	5.78e-56	189	383	0.279	0.274	CASPA_DANRE Caspase a OS=Danio rerio OX=7955 GN=caspa PE=1 SV=1
17	Q504J1	2.43e-42	154	404	0.263	0.245	CASPB_DANRE Caspase b OS=Danio rerio OX=7955 GN=caspb PE=1 SV=1
18	W0TYK3	7.14e-33	124	213	0.172	0.305	W0TYK3_ONCMY Caspase 1b (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=casp1b PE=2 SV=1
19	Q9IB67	1.23e-25	109	423	0.199	0.177	Q9IB67_XENLA Caspase 2 L homeolog OS=Xenopus laevis OX=8355 GN=casp2.L PE=1 SV=1
20	P29594	6.49e-24	104	452	0.199	0.166	CASP2_MOUSE Caspase-2 OS=Mus musculus OX=10090 GN=Casp2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	3.2e-11	54.4	Caspase recruitment domain
2	PF11811 DUF3331	3.4e+02	12.7	Domain of unknown function (DUF3331)
3	PF00656 Peptidase_C14	1.7e-42	157.3	Caspase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000388566

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433209	0.993	Gasdermin-D
2	9606.ENSP00000433138	0.965	Caspase-1
3	9606.ENSP00000280357	0.964	Interleukin-18
4	9606.ENSP00000263341	0.956	Interleukin-1 beta
5	9606.ENSP00000425561	0.902	Eukaryotic translation initiation factor 4E
6	9606.ENSP00000293831	0.901	Eukaryotic initiation factor 4A-I
7	9606.ENSP00000383274	0.901	Eukaryotic translation initiation factor 4 gamma 3
8	9606.ENSP00000416255	0.901	Eukaryotic translation initiation factor 4 gamma 1
9	9606.ENSP00000433664	0.901	Eukaryotic translation initiation factor 4 gamma 2
10	9606.ENSP00000349428	0.900	Polypyrimidine tract-binding protein 1
11	9606.ENSP00000358140	0.900	Eukaryotic translation initiation factor 3 subunit A
12	9606.ENSP00000359216	0.900	Polypyrimidine tract-binding protein 2
13	9606.ENSP00000376849	0.894	Caspase-5
14	9606.ENSP00000337383	0.856	NACHT, LRR and PYD domains-containing protein 3
15	9606.ENSP00000247470	0.841	Apoptosis-associated speck-like protein containing a CARD
16	9606.ENSP00000385090	0.827	NLR family CARD domain-containing protein 4
17	9606.ENSP00000448165	0.812	Apoptotic protease-activating factor 1
18	9606.ENSP00000222823	0.803	Nucleotide-binding oligomerization domain-containing protein 1
19	9606.ENSP00000357112	0.791	Interferon-inducible protein AIM2
20	9606.ENSP00000478516	0.782	NACHT, LRR and PYD domains-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0019904	0.989	protein domain specific binding
GO:0019899	0.648	enzyme binding
GO:0098772	0.572	molecular function regulator activity
GO:0042802	0.528	identical protein binding
GO:0140677	0.512	molecular function activator activity
GO:0030234	0.402	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0012501	0.989	programmed cell death
GO:0051716	0.986	cellular response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0008152	0.977	metabolic process
GO:0071704	0.963	organic substance metabolic process
GO:0048522	0.962	positive regulation of cellular process
GO:0048583	0.947	regulation of response to stimulus
GO:0043170	0.946	macromolecule metabolic process
GO:0019538	0.941	protein metabolic process
GO:0006915	0.923	apoptotic process
GO:0006950	0.921	response to stress
GO:0060759	0.825	regulation of response to cytokine stimulus
GO:0019222	0.816	regulation of metabolic process
GO:0060255	0.805	regulation of macromolecule metabolic process
GO:0007154	0.745	cell communication
GO:0023051	0.735	regulation of signaling
GO:0009966	0.728	regulation of signal transduction
GO:0048584	0.707	positive regulation of response to stimulus
GO:0007165	0.705	signal transduction
GO:0042221	0.698	response to chemical
GO:0009893	0.690	positive regulation of metabolic process
GO:0051171	0.681	regulation of nitrogen compound metabolic process
GO:0080090	0.678	regulation of primary metabolic process
GO:0009605	0.655	response to external stimulus
GO:0006508	0.652	proteolysis
GO:0010604	0.621	positive regulation of macromolecule metabolic process
GO:0006952	0.595	defense response
GO:0010033	0.590	response to organic substance
GO:0010468	0.550	regulation of gene expression
GO:0010941	0.502	regulation of cell death
GO:0080134	0.493	regulation of response to stress
GO:0042981	0.486	regulation of apoptotic process
GO:0051246	0.466	regulation of protein metabolic process
GO:0023056	0.464	positive regulation of signaling
GO:0010647	0.464	positive regulation of cell communication
GO:0009967	0.453	positive regulation of signal transduction
GO:0031349	0.452	positive regulation of defense response
GO:0044419	0.451	biological process involved in interspecies interaction between organisms
GO:0009607	0.450	response to biotic stimulus
GO:0065009	0.448	regulation of molecular function
GO:0071310	0.443	cellular response to organic substance
GO:0051707	0.432	response to other organism
GO:0032101	0.431	regulation of response to external stimulus
GO:0051173	0.386	positive regulation of nitrogen compound metabolic process
GO:0001817	0.382	regulation of cytokine production
GO:0097190	0.381	apoptotic signaling pathway
GO:0032103	0.366	positive regulation of response to external stimulus
GO:0050790	0.361	regulation of catalytic activity
GO:0030162	0.345	regulation of proteolysis
GO:0009617	0.324	response to bacterium
GO:0051247	0.322	positive regulation of protein metabolic process
GO:0098542	0.321	defense response to other organism
GO:0010628	0.320	positive regulation of gene expression
GO:0044093	0.317	positive regulation of molecular function
GO:0035556	0.314	intracellular signal transduction
GO:0001819	0.313	positive regulation of cytokine production
GO:0050727	0.311	regulation of inflammatory response
GO:0002376	0.308	immune system process
GO:0051336	0.304	regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.994	membrane
GO:0012505	0.986	endomembrane system
GO:0005886	0.969	plasma membrane
GO:0005783	0.613	endoplasmic reticulum
GO:0005739	0.474	mitochondrion
GO:0005576	0.315	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]