StarFunc result for job id P49675

User Input

>input (285 residues)
MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLG
SRLEETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF
RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVG
PRDFVSVRCAKRRGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT
WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49675	1.000	1.000	6.712E-53	285	1.000	1.000	P49675.pdb.gz	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
2	AFDB:P51557	0.793	0.795	4.874E-46	284	0.870	0.873	P51557.pdb.gz	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
3	AFDB:Q9DG10	0.756	0.756	3.845E-36	285	0.628	0.628	Q9DG10.pdb.gz	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
4	AFDB:Q61542	0.739	0.478	8.796E-24	446	0.284	0.182	Q61542.pdb.gz	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
5	AFDB:J3QLM1	0.641	0.390	5.878E-20	475	0.260	0.156	J3QLM1.pdb.gz	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
6	AFDB:Q9NSY2	0.682	0.904	1.097E-17	213	0.186	0.249	Q9NSY2.pdb.gz	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
7	PDB:2r55A	0.668	0.906	2.934E-17	208	0.168	0.231	2r55A.pdb.gz
8	PDB:5brlA	0.648	0.868	3.158E-15	210	0.133	0.181	5brlA.pdb.gz
9	AFDB:Q99JV5	0.666	0.839	3.361E-15	224	0.140	0.179	Q99JV5.pdb.gz	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
10	PDB:6l1dA	0.630	0.887	1.003E-14	200	0.126	0.180	6l1dA.pdb.gz
11	AFDB:Q96DR4	0.631	0.867	3.039E-14	205	0.123	0.171	Q96DR4.pdb.gz	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
12	AFDB:Q9EQG9	0.602	0.291	6.275E-13	624	0.151	0.069	Q9EQG9.pdb.gz	CERT_MOUSE Ceramide transfer protein OS=Mus musculus OX=10090 GN=Cert1 PE=1 SV=1
13	AFDB:Q923Q2	0.549	0.159	7.005E-13	1113	0.196	0.050	Q923Q2.pdb.gz	STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus OX=10090 GN=Stard13 PE=1 SV=5
14	PDB:6serA	0.597	0.688	5.045E-12	245	0.140	0.163	6serA.pdb.gz
15	PDB:1ln1A	0.498	0.675	7.909E-11	203	0.123	0.172	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
16	PDB:2qimA	0.368	0.610	1.360E-5	157	0.074	0.134	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
17	PDB:2flhB	0.385	0.653	2.492E-5	153	0.067	0.124	2flhB.pdb.gz	Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin.
18	PDB:4c9iF	0.347	0.547	2.492E-5	162	0.074	0.130	4c9iF.pdb.gz	The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.
19	PDB:6ka2B	0.356	0.594	3.467E-5	152	0.091	0.171	6ka2B.pdb.gz	Structural insights into thebaine synthase 2 catalysis.
20	PDB:3w9rA	0.340	0.509	4.089E-5	171	0.074	0.123	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49675	0.0	592	285	1.000	1.000	STAR_HUMAN Steroidogenic acute regulatory protein, mitochondrial OS=Homo sapiens OX=9606 GN=STAR PE=1 SV=2
2	P51557	0.0	518	284	0.870	0.873	STAR_MOUSE Steroidogenic acute regulatory protein, mitochondrial OS=Mus musculus OX=10090 GN=Star PE=1 SV=1
3	P97826	0.0	523	284	0.877	0.880	STAR_RAT Steroidogenic acute regulatory protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Star PE=1 SV=1
4	Q9DG10	8.49e-136	387	285	0.628	0.628	STAR_DANRE Steroidogenic acute regulatory protein, mitochondrial OS=Danio rerio OX=7955 GN=star PE=2 SV=1
5	Q14849	1.76e-40	147	445	0.274	0.175	STAR3_HUMAN StAR-related lipid transfer protein 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=2
6	Q61542	3.85e-39	144	446	0.267	0.170	STAR3_MOUSE StAR-related lipid transfer protein 3 OS=Mus musculus OX=10090 GN=Stard3 PE=1 SV=1
7	J3QLM1	3.12e-30	120	475	0.228	0.137	J3QLM1_HUMAN StAR related lipid transfer domain containing 3 OS=Homo sapiens OX=9606 GN=STARD3 PE=1 SV=1
8	Q9NSY2	4.58e-15	74.3	213	0.179	0.239	STAR5_HUMAN StAR-related lipid transfer protein 5 OS=Homo sapiens OX=9606 GN=STARD5 PE=1 SV=2
9	Q96DR4	1.74e-07	52.8	205	0.130	0.180	STAR4_HUMAN StAR-related lipid transfer protein 4 OS=Homo sapiens OX=9606 GN=STARD4 PE=1 SV=1
10	Q99JV5	3.15e-07	52.4	224	0.112	0.143	STAR4_MOUSE StAR-related lipid transfer protein 4 OS=Mus musculus OX=10090 GN=Stard4 PE=1 SV=1
11	F4JSE7	2.53e-04	44.7	718	0.137	0.054	EDR2_ARATH Protein ENHANCED DISEASE RESISTANCE 2 OS=Arabidopsis thaliana OX=3702 GN=EDR2 PE=2 SV=1
12	H0YFF3	0.004	39.3	169	0.105	0.178	H0YFF3_HUMAN StAR related lipid transfer domain containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1
13	F5GY11	0.007	39.7	245	0.109	0.127	F5GY11_HUMAN StAR related lipid transfer domain containing 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1
14	F5H1Z6	0.007	39.7	252	0.102	0.115	F5H1Z6_HUMAN StAR related lipid transfer domain containing 10 (Fragment) OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1
15	Q9Y365	0.007	39.7	291	0.102	0.100	STA10_HUMAN START domain-containing protein 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=2
16	F5H8H3	0.008	39.7	262	0.109	0.118	F5H8H3_HUMAN StAR related lipid transfer domain containing 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=1
17	Q9JMD3	0.009	39.3	291	0.109	0.107	STA10_MOUSE START domain-containing protein 10 OS=Mus musculus OX=10090 GN=Stard10 PE=1 SV=1
18	Q8VHQ9	0.046	37.7	594	0.074	0.035	ACO11_MOUSE Acyl-coenzyme A thioesterase 11 OS=Mus musculus OX=10090 GN=Acot11 PE=1 SV=1
19	Q9Y3M8	0.66	33.9	1113	0.179	0.046	STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13 PE=1 SV=2
20	Q9P2P6	1.1	33.5	4700	0.116	0.007	STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens OX=9606 GN=STARD9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03364 Polyketide_cyc	26	16.4	Polyketide cyclase / dehydrase and lipid transport
2	PF01852 START	1.9e-53	192.5	START domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000276449

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379563	0.986	Translocator protein
2	9606.ENSP00000265333	0.978	Voltage-dependent anion-selective channel protein 1
3	9606.ENSP00000268053	0.976	Cholesterol side-chain cleavage enzyme, mitochondrial
4	9606.ENSP00000009041	0.966	STARD3 N-terminal-like protein
5	9606.ENSP00000361635	0.959	Voltage-dependent anion-selective channel protein 2
6	9606.ENSP00000358903	0.945	Steroid 17-alpha-hydroxylase/17,20 lyase
7	9606.ENSP00000296632	0.926	StAR-related lipid transfer protein 4
8	9606.ENSP00000462349	0.921	StAR-related lipid transfer protein 6
9	9606.ENSP00000337446	0.913	StAR-related lipid transfer protein 3
10	9606.ENSP00000358421	0.906	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
11	9606.ENSP00000260270	0.903	Adrenodoxin, mitochondrial
12	9606.ENSP00000428845	0.886	Voltage-dependent anion-selective channel protein 3
13	9606.ENSP00000362690	0.861	Steroidogenic factor 1
14	9606.ENSP00000379683	0.855	Aromatase
15	9606.ENSP00000416515	0.846	NADPH:adrenodoxin oxidoreductase, mitochondrial
16	9606.ENSP00000445122	0.823	3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
17	9606.ENSP00000364412	0.805	Testosterone 17-beta-dehydrogenase 3
18	9606.ENSP00000292427	0.799	Cytochrome P450 11B1, mitochondrial
19	9606.ENSP00000244289	0.786	Hormone-sensitive lipase
20	9606.ENSP00000482704	0.763	Dehydrogenase/reductase SDR family member 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015485	1.000	cholesterol binding
GO:0005215	0.891	transporter activity
GO:0015248	0.850	sterol transporter activity
GO:0120013	0.731	lipid transfer activity
GO:0120015	0.665	sterol transfer activity
GO:0120020	0.628	cholesterol transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0071704	0.994	organic substance metabolic process
GO:0050789	0.993	regulation of biological process
GO:0044238	0.992	primary metabolic process
GO:0009987	0.984	cellular process
GO:0050794	0.970	regulation of cellular process
GO:0019216	0.969	regulation of lipid metabolic process
GO:0008202	0.952	steroid metabolic process
GO:0006694	0.944	steroid biosynthetic process
GO:0019218	0.940	regulation of steroid metabolic process
GO:0048518	0.924	positive regulation of biological process
GO:0009893	0.890	positive regulation of metabolic process
GO:0009889	0.849	regulation of biosynthetic process
GO:0031326	0.771	regulation of cellular biosynthetic process
GO:0050810	0.742	regulation of steroid biosynthetic process
GO:0048522	0.671	positive regulation of cellular process
GO:0044237	0.663	cellular metabolic process
GO:0009891	0.606	positive regulation of biosynthetic process
GO:0062012	0.589	regulation of small molecule metabolic process
GO:0050896	0.476	response to stimulus
GO:0051716	0.356	cellular response to stimulus
GO:0065008	0.318	regulation of biological quality
GO:0032501	0.313	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.988	intracellular organelle lumen
GO:0016020	0.904	membrane
GO:0005740	0.628	mitochondrial envelope
GO:0005829	0.395	cytosol
GO:0031090	0.385	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:39747	0.850	cholesterol(in) = cholesterol(out)

[back to server]