StarFunc result for job id P49711

User Input

>input (727 residues)
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN
QPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEM
ILSMMDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R1D1	0.544	0.537	0.000	737	0.992	0.978	Q9R1D1.pdb.gz	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
2	AFDB:Q8NI51	0.430	0.469	8.475E-57	663	0.415	0.456	Q8NI51.pdb.gz	CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=2
3	AFDB:Q8TA44	0.301	0.270	2.051E-40	818	0.290	0.258	Q8TA44.pdb.gz	Q8TA44_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=1
4	AFDB:A0A024RC04	0.169	0.156	1.186E-25	805	0.187	0.169	A0A024RC04.pdb.gz
5	AFDB:P08970	0.145	0.117	2.574E-23	941	0.198	0.153	P08970.pdb.gz	SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster OX=7227 GN=su(Hw) PE=1 SV=2
6	AFDB:E7FAN3	0.219	0.210	1.831E-22	764	0.188	0.179	E7FAN3.pdb.gz	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
7	AFDB:P20662	0.147	0.140	3.914E-22	777	0.173	0.162	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
8	AFDB:Q9VI93	0.168	0.135	5.282E-16	946	0.168	0.129	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
9	AFDB:Q4WT96	0.168	0.209	1.301E-13	570	0.129	0.165	Q4WT96.pdb.gz	Q4WT96_ASPFU C2H2 transcription factor, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G10080 PE=4 SV=1
10	AFDB:Q14526	0.146	0.145	3.498E-12	733	0.124	0.123	Q14526.pdb.gz	HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1 PE=1 SV=5
11	PDB:3w5kB	0.073	0.259	5.094E-5	110	0.047	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5apny	0.045	0.114	1.682E-1	211	0.045	0.156	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
13	PDB:6ydhA	0.031	0.243	4.630E-1	62	0.021	0.242	6ydhA.pdb.gz
14	PDB:7pt6I	0.051	0.096	8.720E-1	341	0.047	0.100	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
15	PDB:5khrN	0.043	0.048	9.290E-1	645	0.023	0.026	5khrN.pdb.gz
16	PDB:4wa6D	0.037	0.062	1.123	415	0.022	0.039	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
17	PDB:6o9lQ	0.035	0.045	1.123	430	0.040	0.067	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
18	PDB:3mhhC	0.042	0.219	1.447	93	0.015	0.118	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
19	PDB:6ff4t	0.032	0.093	1.541	172	0.034	0.145	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7uhyC	0.037	0.043	1.642	578	0.017	0.021	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YFL0	0.0	1504	725	0.997	1.000	A0A2R8YFL0_HUMAN CCCTC-binding factor OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
2	P49711	0.0	1512	727	1.000	1.000	CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
3	Q08705	0.0	1230	728	0.935	0.934	CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus OX=9031 GN=CTCF PE=1 SV=1
4	Q61164	0.0	1488	736	0.992	0.980	CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus OX=10090 GN=Ctcf PE=1 SV=2
5	Q6JAA4	0.0	989	798	0.776	0.707	Q6JAA4_DANRE CCCTC-binding factor OS=Danio rerio OX=7955 GN=im:7152666 PE=1 SV=1
6	Q8NI51	0.0	550	663	0.355	0.389	CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=2
7	Q9R1D1	0.0	1491	737	0.992	0.978	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
8	V9GY73	8.04e-179	526	627	0.333	0.386	V9GY73_HUMAN CCCTC-binding factor like OS=Homo sapiens OX=9606 GN=CTCFL PE=1 SV=1
9	A2APF3	2.76e-174	515	636	0.373	0.426	CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus OX=10090 GN=Ctcfl PE=1 SV=1
10	A0A2R8Y6C1	1.88e-108	328	163	0.224	1.000	A0A2R8Y6C1_HUMAN CCCTC-binding factor (Fragment) OS=Homo sapiens OX=9606 GN=CTCF PE=1 SV=1
11	Q9VS55	3.19e-87	293	818	0.210	0.187	Q9VS55_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=2
12	Q8TA44	7.50e-87	293	818	0.210	0.187	Q8TA44_DROME CTCF OS=Drosophila melanogaster OX=7227 GN=CTCF PE=1 SV=1
13	Q9UJW8	1.67e-58	212	692	0.160	0.168	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
14	Q15937	5.90e-58	206	498	0.193	0.281	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
15	Q9UEG4	6.22e-58	213	869	0.173	0.145	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
16	Q9NQZ8	9.42e-58	206	489	0.164	0.243	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
17	Q6ECI4	1.84e-57	210	717	0.164	0.166	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
18	P52742	1.22e-56	206	658	0.162	0.179	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
19	Q8IZ26	1.38e-55	201	560	0.164	0.212	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
20	A0A0C4DG42	1.60e-55	201	539	0.164	0.221	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	3.2e-30	114.0	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	1.1e-22	89.7	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	58	15.1	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	0.00018	32.9	Zinc-finger double-stranded RNA-binding
5	PF16278 zf-C2HE	63	15.5	C2HE / C2H2 / C2HC zinc-binding finger
6	PF13465 zf-H2C2_2	8.8e-48	169.9	Zinc-finger double domain
7	PF13909 zf-H2C2_5	3.2e-15	66.9	C2H2-type zinc-finger domain
8	PF12874 zf-met	11	17.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296930	0.996	Nucleophosmin
2	9606.ENSP00000297338	0.996	Double-strand-break repair protein rad21 homolog
3	9606.ENSP00000382863	0.993	Chromodomain-helicase-DNA-binding protein 8
4	9606.ENSP00000316578	0.992	Polycomb protein SUZ12
5	9606.ENSP00000218089	0.991	Cohesin subunit SA-2
6	9606.ENSP00000259915	0.981	POU domain, class 5, transcription factor 1
7	9606.ENSP00000378402	0.979	Paired amphipathic helix protein Sin3a
8	9606.ENSP00000479618	0.970	Myc proto-oncogene protein
9	9606.ENSP00000225792	0.966	Probable ATP-dependent RNA helicase DDX5
10	9606.ENSP00000354720	0.960	Structural maintenance of chromosomes protein 3
11	9606.ENSP00000418915	0.958	Cyclin-dependent kinase inhibitor 2A
12	9606.ENSP00000355759	0.950	Poly [ADP-ribose] polymerase 1
13	9606.ENSP00000263253	0.944	Histone acetyltransferase p300
14	9606.ENSP00000341551	0.938	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000441954	0.932	Mothers against decapentaplegic homolog 5
16	9606.ENSP00000480158	0.930	DNA-directed RNA polymerase II subunit RPB1
17	9606.ENSP00000391826	0.928	Insulin-like growth factor II
18	9606.ENSP00000228872	0.920	Cyclin-dependent kinase inhibitor 1B
19	9606.ENSP00000296417	0.920	Histone H2A.Z
20	9606.ENSP00000288840	0.911	Mothers against decapentaplegic homolog 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.999	DNA binding
GO:0003700	0.992	DNA-binding transcription factor activity
GO:0008134	0.966	transcription factor binding
GO:0000976	0.955	transcription cis-regulatory region binding
GO:0140297	0.931	DNA-binding transcription factor binding
GO:0000981	0.772	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.605	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.439	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0010468	0.992	regulation of gene expression
GO:0048519	0.991	negative regulation of biological process
GO:0019219	0.988	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0010605	0.979	negative regulation of macromolecule metabolic process
GO:0006357	0.975	regulation of transcription by RNA polymerase II
GO:0048518	0.952	positive regulation of biological process
GO:0009987	0.947	cellular process
GO:0048522	0.860	positive regulation of cellular process
GO:0048523	0.820	negative regulation of cellular process
GO:0071840	0.805	cellular component organization or biogenesis
GO:0006325	0.797	chromatin organization
GO:0009893	0.778	positive regulation of metabolic process
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0051173	0.757	positive regulation of nitrogen compound metabolic process
GO:0031325	0.738	positive regulation of cellular metabolic process
GO:0051172	0.716	negative regulation of nitrogen compound metabolic process
GO:0031324	0.716	negative regulation of cellular metabolic process
GO:0045935	0.698	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.696	positive regulation of cellular biosynthetic process
GO:0010557	0.695	positive regulation of macromolecule biosynthetic process
GO:0045893	0.690	positive regulation of DNA-templated transcription
GO:0045934	0.676	negative regulation of nucleobase-containing compound metabolic process
GO:0008152	0.572	metabolic process
GO:0051253	0.543	negative regulation of RNA metabolic process
GO:0010558	0.536	negative regulation of macromolecule biosynthetic process
GO:0031327	0.535	negative regulation of cellular biosynthetic process
GO:0071704	0.522	organic substance metabolic process
GO:0045892	0.518	negative regulation of DNA-templated transcription
GO:0044238	0.505	primary metabolic process
GO:0044237	0.488	cellular metabolic process
GO:0006807	0.464	nitrogen compound metabolic process
GO:0043170	0.395	macromolecule metabolic process
GO:0045944	0.357	positive regulation of transcription by RNA polymerase II
GO:0050896	0.342	response to stimulus
GO:0040029	0.300	epigenetic regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043228	0.962	non-membrane-bounded organelle
GO:0043232	0.931	intracellular non-membrane-bounded organelle
GO:0032991	0.447	protein-containing complex
GO:0005730	0.407	nucleolus
GO:0001652	0.365	granular component
GO:0001651	0.365	dense fibrillar component

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]