StarFunc result for job id P49715

User Input

>input (358 residues)
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53566	0.671	0.669	5.220E-47	359	0.947	0.944	P53566.pdb.gz	CEBPA_MOUSE CCAAT/enhancer-binding protein alpha OS=Mus musculus OX=10090 GN=Cebpa PE=1 SV=2
2	AFDB:Q4H3V8	0.137	0.143	1.633E-3	340	0.182	0.191	Q4H3V8.pdb.gz	Q4H3V8_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF4/5 PE=1 SV=1
3	AFDB:Q9VI54	0.088	0.042	6.265E-2	905	0.156	0.062	Q9VI54.pdb.gz	Q9VI54_DROME LD29489p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1965 PE=1 SV=3
4	AFDB:F6VAN0	0.158	0.092	8.294E-2	656	0.176	0.096	F6VAN0.pdb.gz	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
5	AFDB:Q5RH85	0.168	0.097	1.178E-1	653	0.156	0.086	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
6	AFDB:P18850	0.172	0.099	1.263E-1	670	0.168	0.090	P18850.pdb.gz	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
7	AFDB:Q06507	0.181	0.184	1.355E-1	349	0.162	0.166	Q06507.pdb.gz	ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 OS=Mus musculus OX=10090 GN=Atf4 PE=1 SV=2
8	AFDB:Q99941	0.143	0.082	2.548E-1	703	0.187	0.095	Q99941.pdb.gz	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
9	AFDB:Q57YX2	0.091	0.027	3.373E-1	1518	0.126	0.030	Q57YX2.pdb.gz	Q57YX2_TRYB2 Inositol hexakisphosphate OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.520 PE=4 SV=1
10	AFDB:Q96AQ6	0.137	0.079	3.880E-1	731	0.154	0.075	Q96AQ6.pdb.gz	PBIP1_HUMAN Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1
11	PDB:5wlcNB	0.066	0.149	8.312	142	0.028	0.070	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:6k15L	0.050	0.174	8.916	85	0.020	0.082	6k15L.pdb.gz	Structure of the RSC complex bound to the nucleosome.
13	PDB:7odrl	0.077	0.303	8.916	82	0.028	0.122	7odrl.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1RNW6	0.0	667	354	0.955	0.966	F1RNW6_PIG CCAAT enhancer binding protein alpha OS=Sus scrofa OX=9823 GN=CEBPA PE=3 SV=1
2	P49715	0.0	709	358	1.000	1.000	CEBPA_HUMAN CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3
3	P05554	1.51e-167	473	358	0.933	0.933	CEBPA_RAT CCAAT/enhancer-binding protein alpha OS=Rattus norvegicus OX=10116 GN=Cebpa PE=1 SV=3
4	P53566	2.75e-166	470	359	0.936	0.933	CEBPA_MOUSE CCAAT/enhancer-binding protein alpha OS=Mus musculus OX=10090 GN=Cebpa PE=1 SV=2
5	Q90582	1.62e-120	352	324	0.634	0.701	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
6	Q8UVZ1	2.65e-93	282	288	0.511	0.635	Q8UVZ1_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=c/ebpa PE=2 SV=1
7	A5X2V8	6.44e-85	261	320	0.520	0.581	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
8	Q15744	2.14e-45	158	281	0.355	0.452	CEBPE_HUMAN CCAAT/enhancer-binding protein epsilon OS=Homo sapiens OX=9606 GN=CEBPE PE=1 SV=2
9	P56261	1.88e-44	156	281	0.349	0.445	CEBPE_RAT CCAAT/enhancer-binding protein epsilon OS=Rattus norvegicus OX=10116 GN=Cebpe PE=1 SV=2
10	Q6PZD9	2.05e-44	156	281	0.344	0.438	CEBPE_MOUSE CCAAT/enhancer-binding protein epsilon OS=Mus musculus OX=10090 GN=Cebpe PE=1 SV=1
11	A5X2W0	8.98e-33	126	304	0.285	0.336	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
12	Q05826	2.62e-32	125	328	0.162	0.177	CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus OX=9031 GN=CEBPB PE=1 SV=1
13	O97894	7.53e-32	116	69	0.145	0.754	O97894_PIG CCAAT/enhancer binding protein beta (Fragment) OS=Sus scrofa OX=9823 GN=C/EBP beta PE=2 SV=1
14	P28033	7.52e-31	120	296	0.162	0.196	CEBPB_MOUSE CCAAT/enhancer-binding protein beta OS=Mus musculus OX=10090 GN=Cebpb PE=1 SV=1
15	P21272	1.65e-30	119	297	0.162	0.195	CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus OX=10116 GN=Cebpb PE=1 SV=1
16	Q7ZU07	9.72e-29	114	280	0.159	0.204	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
17	Q7SZH5	8.27e-26	107	291	0.145	0.179	Q7SZH5_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=C/EBPbeta PE=2 SV=1
18	P49716	1.08e-23	100	269	0.134	0.178	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
19	A5X2V9	2.23e-23	100	294	0.142	0.173	A5X2V9_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00073775001 PE=2 SV=1
20	Q03484	2.52e-23	99.8	268	0.128	0.172	CEBPD_RAT CCAAT/enhancer-binding protein delta OS=Rattus norvegicus OX=10116 GN=Cebpd PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.096	24.1	bZIP transcription factor
2	PF07716 bZIP_2	4.7e-12	57.1	Basic region leucine zipper
3	PF03131 bZIP_Maf	69	15.4	bZIP Maf transcription factor
4	PF04977 DivIC	3.9e+02	12.2	Septum formation initiator
5	PF13851 GAS	1.7e+02	13.0	Growth-arrest specific micro-tubule binding
6	PF08720 Hema_stalk	4.8e+02	11.8	Influenza C hemagglutinin stalk
7	PF13942 Lipoprotein_20	2.5e+02	13.0	YfhG lipoprotein
8	PF13874 Nup54	8.3e+02	11.5	Nucleoporin complex subunit 54
9	PF09728 Taxilin	11	16.7	Myosin-like coiled-coil protein
10	PF16331 TolA_bind_tri	23	16.5	TolA binding protein trimerisation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427514

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000360266	0.998	Transcription factor AP-1
3	9606.ENSP00000368686	0.998	Transcription factor E2F4
4	9606.ENSP00000287820	0.995	Peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000362649	0.994	Histone deacetylase 1
6	9606.ENSP00000227163	0.993	Transcription factor PU.1
7	9606.ENSP00000263253	0.993	Histone acetyltransferase p300
8	9606.ENSP00000306245	0.991	Proto-oncogene c-Fos
9	9606.ENSP00000257904	0.990	Cyclin-dependent kinase 4
10	9606.ENSP00000368880	0.989	Forkhead box protein O1
11	9606.ENSP00000231509	0.985	Glucocorticoid receptor
12	9606.ENSP00000376436	0.984	Protein C-ets-1
13	9606.ENSP00000389814	0.979	Adiponectin
14	9606.ENSP00000262367	0.978	CREB-binding protein
15	9606.ENSP00000305422	0.977	CCAAT/enhancer-binding protein beta
16	9606.ENSP00000312150	0.977	Tribbles homolog 1
17	9606.ENSP00000366915	0.976	Krueppel-like factor 5
18	9606.ENSP00000267163	0.974	Retinoblastoma-associated protein
19	9606.ENSP00000479618	0.974	Myc proto-oncogene protein
20	9606.ENSP00000353344	0.972	Protein C-ets-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.995	cis-regulatory region sequence-specific DNA binding
GO:0019899	0.994	enzyme binding
GO:0042802	0.993	identical protein binding
GO:0140297	0.990	DNA-binding transcription factor binding
GO:0000978	0.989	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019900	0.969	kinase binding
GO:0003682	0.877	chromatin binding
GO:0031490	0.849	chromatin DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.998	regulation of gene expression
GO:0009889	0.997	regulation of biosynthetic process
GO:0019219	0.997	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.994	positive regulation of macromolecule metabolic process
GO:0009987	0.989	cellular process
GO:0051173	0.978	positive regulation of nitrogen compound metabolic process
GO:1903506	0.978	regulation of nucleic acid-templated transcription
GO:0031325	0.975	positive regulation of cellular metabolic process
GO:0006355	0.974	regulation of DNA-templated transcription
GO:0010557	0.946	positive regulation of macromolecule biosynthetic process
GO:0045935	0.946	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.945	response to stimulus
GO:0031328	0.945	positive regulation of cellular biosynthetic process
GO:0045893	0.943	positive regulation of DNA-templated transcription
GO:0045944	0.911	positive regulation of transcription by RNA polymerase II
GO:0048519	0.909	negative regulation of biological process
GO:0042221	0.886	response to chemical
GO:0051716	0.881	cellular response to stimulus
GO:0048523	0.866	negative regulation of cellular process
GO:0010605	0.831	negative regulation of macromolecule metabolic process
GO:0051172	0.815	negative regulation of nitrogen compound metabolic process
GO:0031324	0.811	negative regulation of cellular metabolic process
GO:0032502	0.805	developmental process
GO:0042127	0.782	regulation of cell population proliferation
GO:0010033	0.779	response to organic substance
GO:0070887	0.750	cellular response to chemical stimulus
GO:0048856	0.747	anatomical structure development
GO:0008152	0.728	metabolic process
GO:0071704	0.723	organic substance metabolic process
GO:0044237	0.647	cellular metabolic process
GO:0007165	0.641	signal transduction
GO:0044238	0.636	primary metabolic process
GO:0071310	0.631	cellular response to organic substance
GO:0045934	0.573	negative regulation of nucleobase-containing compound metabolic process
GO:0006807	0.568	nitrogen compound metabolic process
GO:0009890	0.559	negative regulation of biosynthetic process
GO:0032501	0.517	multicellular organismal process
GO:0051253	0.510	negative regulation of RNA metabolic process
GO:0010558	0.506	negative regulation of macromolecule biosynthetic process
GO:0031327	0.505	negative regulation of cellular biosynthetic process
GO:0045892	0.500	negative regulation of DNA-templated transcription
GO:0050793	0.450	regulation of developmental process
GO:0010628	0.419	positive regulation of gene expression
GO:0045595	0.417	regulation of cell differentiation
GO:0043170	0.380	macromolecule metabolic process
GO:0051239	0.371	regulation of multicellular organismal process
GO:0030154	0.371	cell differentiation
GO:0006950	0.366	response to stress
GO:0048583	0.355	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005667	0.999	transcription regulator complex
GO:0005654	0.998	nucleoplasm
GO:0043228	0.995	non-membrane-bounded organelle
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0140513	0.912	nuclear protein-containing complex
GO:0090575	0.817	RNA polymerase II transcription regulator complex
GO:0005730	0.569	nucleolus
GO:0005737	0.559	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]