StarFunc result for job id P49716

User Input

>input (269 residues)
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRDLAGLRQFFKQLPSPPFLPAAGTADCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49716	1.000	1.000	3.238E-39	269	1.000	1.000	P49716.pdb.gz	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
2	AFDB:Q00322	0.794	0.797	1.717E-32	268	0.859	0.862	Q00322.pdb.gz	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2
3	AFDB:A5X2W0	0.340	0.306	1.275E-15	304	0.494	0.438	A5X2W0.pdb.gz	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
4	AFDB:A5X2V8	0.259	0.220	2.590E-9	320	0.364	0.306	A5X2V8.pdb.gz	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
5	AFDB:Q7ZU07	0.265	0.255	6.659E-7	280	0.323	0.311	Q7ZU07.pdb.gz	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
6	AFDB:A0A024QZG3	0.247	0.238	5.263E-3	282	0.227	0.216	A0A024QZG3.pdb.gz
7	AFDB:Q02637	0.260	0.156	9.750E-3	449	0.227	0.136	Q02637.pdb.gz	CEBP_DROME CCAAT/enhancer-binding protein OS=Drosophila melanogaster OX=7227 GN=slbo PE=1 SV=3
8	AFDB:Q9NS37	0.234	0.180	3.346E-2	354	0.193	0.147	Q9NS37.pdb.gz	ZHANG_HUMAN CREB/ATF bZIP transcription factor OS=Homo sapiens OX=9606 GN=CREBZF PE=1 SV=2
9	AFDB:Q3UZ45	0.218	0.165	4.713E-2	379	0.186	0.132	Q3UZ45.pdb.gz	MCIN_MOUSE Multicilin OS=Mus musculus OX=10090 GN=Mcidas PE=1 SV=1
10	AFDB:Q8N6Y0	0.220	0.096	1.317E-1	703	0.175	0.067	Q8N6Y0.pdb.gz	USBP1_HUMAN Harmonin-binding protein USHBP1 OS=Homo sapiens OX=9606 GN=USHBP1 PE=1 SV=1
11	PDB:7dvqR	0.179	0.197	1.714	241	0.119	0.133	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5u6yA	0.074	0.050	5.128	459	0.037	0.022	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49716	0.0	530	269	1.000	1.000	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
2	Q03484	2.08e-154	432	268	0.870	0.873	CEBPD_RAT CCAAT/enhancer-binding protein delta OS=Rattus norvegicus OX=10116 GN=Cebpd PE=2 SV=1
3	Q00322	2.19e-151	425	268	0.859	0.862	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2
4	A5X2W0	6.73e-75	232	304	0.524	0.464	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
5	Q8UVZ1	6.06e-34	126	288	0.357	0.333	Q8UVZ1_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=c/ebpa PE=2 SV=1
6	Q90582	3.98e-31	119	324	0.368	0.306	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
7	Q6PZD9	6.09e-31	118	281	0.413	0.395	CEBPE_MOUSE CCAAT/enhancer-binding protein epsilon OS=Mus musculus OX=10090 GN=Cebpe PE=1 SV=1
8	P56261	2.00e-30	117	281	0.409	0.391	CEBPE_RAT CCAAT/enhancer-binding protein epsilon OS=Rattus norvegicus OX=10116 GN=Cebpe PE=1 SV=2
9	Q15744	8.58e-30	115	281	0.413	0.395	CEBPE_HUMAN CCAAT/enhancer-binding protein epsilon OS=Homo sapiens OX=9606 GN=CEBPE PE=1 SV=2
10	P17676	3.64e-28	112	345	0.197	0.154	CEBPB_HUMAN CCAAT/enhancer-binding protein beta OS=Homo sapiens OX=9606 GN=CEBPB PE=1 SV=2
11	E5Q8C6	5.26e-26	106	346	0.193	0.150	E5Q8C6_PIG CCAAT/enhancer-binding protein OS=Sus scrofa OX=9823 GN=CEBPB PE=2 SV=1
12	A5X2V8	2.20e-25	104	320	0.230	0.194	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	Q05826	2.71e-25	104	328	0.190	0.155	CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus OX=9031 GN=CEBPB PE=1 SV=1
14	P28033	8.37e-25	102	296	0.186	0.169	CEBPB_MOUSE CCAAT/enhancer-binding protein beta OS=Mus musculus OX=10090 GN=Cebpb PE=1 SV=1
15	P21272	8.70e-25	102	297	0.186	0.168	CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus OX=10116 GN=Cebpb PE=1 SV=1
16	P49715	9.94e-25	103	358	0.178	0.134	CEBPA_HUMAN CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3
17	O97894	1.04e-24	95.9	69	0.164	0.638	O97894_PIG CCAAT/enhancer binding protein beta (Fragment) OS=Sus scrofa OX=9823 GN=C/EBP beta PE=2 SV=1
18	Q7ZU07	3.56e-24	100	280	0.312	0.300	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
19	P53566	8.62e-24	100	359	0.175	0.131	CEBPA_MOUSE CCAAT/enhancer-binding protein alpha OS=Mus musculus OX=10090 GN=Cebpa PE=1 SV=2
20	P05554	8.95e-24	100	358	0.175	0.131	CEBPA_RAT CCAAT/enhancer-binding protein alpha OS=Rattus norvegicus OX=10116 GN=Cebpa PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	0.02	26.6	Autophagy protein 16 (ATG16)
2	PF10211 Ax_dynein_light	6.6e+02	11.6	Axonemal dynein light chain
3	PF00170 bZIP_1	0.2	23.1	bZIP transcription factor
4	PF07716 bZIP_2	1.2e-13	62.2	Basic region leucine zipper
5	PF08172 CASP_C	58	14.5	CASP C terminal
6	PF04977 DivIC	1.7e+02	13.4	Septum formation initiator
7	PF07323 DUF1465	1.4e+02	13.8	Protein of unknown function (DUF1465)
8	PF10721 DUF2514	4.7e+02	12.2	Protein of unknown function (DUF2514)
9	PF13093 FTA4	36	15.7	Kinetochore complex Fta4 of Sim4 subunit, or CENP-50
10	PF13851 GAS	1.6e+02	13.1	Growth-arrest specific micro-tubule binding
11	PF13942 Lipoprotein_20	4.8e+02	12.1	YfhG lipoprotein
12	PF09728 Taxilin	56	14.4	Myosin-like coiled-coil protein
13	PF06785 UPF0242	29	16.2	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305422	0.974	CCAAT/enhancer-binding protein beta
2	9606.ENSP00000287820	0.968	Peroxisome proliferator-activated receptor gamma
3	9606.ENSP00000427514	0.962	CCAAT/enhancer-binding protein alpha
4	9606.ENSP00000306245	0.952	Proto-oncogene c-Fos
5	9606.ENSP00000366915	0.950	Krueppel-like factor 5
6	9606.ENSP00000264657	0.947	Signal transducer and activator of transcription 3
7	9606.ENSP00000323588	0.943	Transcription factor SOX-2
8	9606.ENSP00000479618	0.942	Myc proto-oncogene protein
9	9606.ENSP00000303315	0.936	Transcription factor jun-B
10	9606.ENSP00000286639	0.935	Basic leucine zipper transcriptional factor ATF-like
11	9606.ENSP00000368880	0.932	Forkhead box protein O1
12	9606.ENSP00000227507	0.929	G1/S-specific cyclin-D1
13	9606.ENSP00000384371	0.927	B-cell lymphoma 6 protein
14	9606.ENSP00000437955	0.926	Hypoxia-inducible factor 1-alpha
15	9606.ENSP00000322898	0.923	Transcription factor COE1
16	9606.ENSP00000385824	0.920	Forkhead box protein O3
17	9606.ENSP00000261523	0.917	Nuclear receptor ROR-alpha
18	9606.ENSP00000356840	0.916	POU domain, class 2, transcription factor 1
19	9606.ENSP00000354487	0.911	Zinc finger E-box-binding homeobox 1
20	9606.ENSP00000229307	0.910	Homeobox protein NANOG

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0000976	0.994	transcription cis-regulatory region binding
GO:0000981	0.992	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.967	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.959	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.957	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.948	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.910	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0010468	0.989	regulation of gene expression
GO:0050794	0.988	regulation of cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0009893	0.970	positive regulation of metabolic process
GO:0051252	0.970	regulation of RNA metabolic process
GO:0010604	0.960	positive regulation of macromolecule metabolic process
GO:0010556	0.958	regulation of macromolecule biosynthetic process
GO:0031326	0.958	regulation of cellular biosynthetic process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0048522	0.916	positive regulation of cellular process
GO:0006357	0.871	regulation of transcription by RNA polymerase II
GO:0031325	0.868	positive regulation of cellular metabolic process
GO:0051173	0.865	positive regulation of nitrogen compound metabolic process
GO:0045935	0.823	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.779	positive regulation of biosynthetic process
GO:0071704	0.775	organic substance metabolic process
GO:0044238	0.759	primary metabolic process
GO:0044237	0.754	cellular metabolic process
GO:0010557	0.742	positive regulation of macromolecule biosynthetic process
GO:0031328	0.741	positive regulation of cellular biosynthetic process
GO:0051254	0.735	positive regulation of RNA metabolic process
GO:0006807	0.696	nitrogen compound metabolic process
GO:0045893	0.679	positive regulation of DNA-templated transcription
GO:0043170	0.642	macromolecule metabolic process
GO:0048519	0.582	negative regulation of biological process
GO:0048523	0.541	negative regulation of cellular process
GO:0045944	0.518	positive regulation of transcription by RNA polymerase II
GO:0050896	0.495	response to stimulus
GO:1901360	0.487	organic cyclic compound metabolic process
GO:0034641	0.482	cellular nitrogen compound metabolic process
GO:0046483	0.468	heterocycle metabolic process
GO:0006725	0.468	cellular aromatic compound metabolic process
GO:0009892	0.447	negative regulation of metabolic process
GO:0006139	0.423	nucleobase-containing compound metabolic process
GO:0010605	0.408	negative regulation of macromolecule metabolic process
GO:0010467	0.389	gene expression
GO:0016070	0.369	RNA metabolic process
GO:0051172	0.327	negative regulation of nitrogen compound metabolic process
GO:0031324	0.326	negative regulation of cellular metabolic process
GO:0051716	0.316	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0090575	0.976	RNA polymerase II transcription regulator complex
GO:0005737	0.694	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]