StarFunc result for job id P49721

User Input

>input (201 residues)
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJS6	1.000	1.000	2.006E-42	201	1.000	1.000	A0A140VJS6.pdb.gz	A0A140VJS6_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:4r3oK	0.984	0.994	3.290E-40	199	0.990	1.000	4r3oK.pdb.gz
3	AFDB:Q9VJJ0	0.959	0.959	1.487E-30	201	0.498	0.498	Q9VJJ0.pdb.gz	Q9VJJ0_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta4 PE=1 SV=1
4	AFDB:Q09720	0.943	0.976	3.571E-27	194	0.433	0.448	Q09720.pdb.gz	PSB4_SCHPO Probable proteasome subunit beta type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC31A2.04c PE=3 SV=1
5	AFDB:P22141	0.942	0.956	1.244E-26	198	0.433	0.439	P22141.pdb.gz	PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE1 PE=1 SV=2
6	AFDB:F4JIF9	0.961	0.899	6.564E-26	215	0.428	0.400	F4JIF9.pdb.gz	F4JIF9_ARATH Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=PBD2 PE=1 SV=1
7	PDB:3e47J	0.938	0.952	8.244E-26	198	0.438	0.444	3e47J.pdb.gz	Inhibitor-binding mode of homobelactosin C to proteasomes: new insights into class I MHC ligand generation
8	AFDB:Q55DY7	0.941	0.955	1.829E-24	198	0.428	0.434	Q55DY7.pdb.gz	PSB2_DICDI Proteasome subunit beta type-2 OS=Dictyostelium discoideum OX=44689 GN=psmB2 PE=3 SV=1
9	AFDB:Q9NHC6	0.917	0.895	3.363E-23	206	0.373	0.364	Q9NHC6.pdb.gz	PSB2_TRYBB Proteasome subunit beta type-2 OS=Trypanosoma brucei brucei OX=5702 GN=PSB4 PE=2 SV=1
10	AFDB:A0A140VK45	0.891	0.750	3.028E-18	241	0.239	0.199	A0A140VK45.pdb.gz	A0A140VK45_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
11	AFDB:Q58634	0.875	0.789	4.871E-18	224	0.234	0.210	Q58634.pdb.gz	PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=psmB PE=1 SV=1
12	AFDB:Q54QR2	0.890	0.682	1.506E-17	266	0.179	0.135	Q54QR2.pdb.gz	PSB7_DICDI Proteasome subunit beta type-7 OS=Dictyostelium discoideum OX=44689 GN=psmB7 PE=3 SV=1
13	PDB:8cvsL	0.890	0.843	1.891E-17	213	0.239	0.225	8cvsL.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.
14	PDB:1pma1	0.865	0.857	6.207E-17	203	0.194	0.192	1pma1.pdb.gz
15	PDB:5fgiH	0.859	0.744	3.277E-16	234	0.179	0.154	5fgiH.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
16	PDB:5fgiN	0.876	0.830	3.690E-16	213	0.199	0.188	5fgiN.pdb.gz	A unified mechanism for proteolysis and autocatalytic activation in the 20S proteasome.
17	PDB:1j2qH	0.848	0.844	5.271E-16	202	0.224	0.223	1j2qH.pdb.gz	Investigations on the Maturation and Regulation of Archaebacterial Proteasomes
18	PDB:8cvtR	0.873	0.873	5.271E-16	201	0.179	0.179	8cvtR.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.
19	PDB:3h4pa	0.879	0.875	5.593E-16	202	0.229	0.228	3h4pa.pdb.gz
20	PDB:8cvtP	0.883	0.867	7.989E-16	205	0.174	0.171	8cvtP.pdb.gz	Structural insights into the human PA28-20S proteasome enabled by efficient tagging and purification of endogenous proteins.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJS6	1.12e-150	417	201	1.000	1.000	A0A140VJS6_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	P49721	1.12e-150	417	201	1.000	1.000	PSB2_HUMAN Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1
3	Q9R1P3	4.45e-146	405	201	0.965	0.965	PSB2_MOUSE Proteasome subunit beta type-2 OS=Mus musculus OX=10090 GN=Psmb2 PE=1 SV=1
4	P40307	1.03e-136	382	201	0.960	0.960	PSB2_RAT Proteasome subunit beta type-2 OS=Rattus norvegicus OX=10116 GN=Psmb2 PE=1 SV=1
5	Q9VJJ0	4.28e-75	226	201	0.498	0.498	Q9VJJ0_DROME Proteasome subunit beta OS=Drosophila melanogaster OX=7227 GN=Prosbeta4 PE=1 SV=1
6	P22141	8.30e-60	187	198	0.433	0.439	PSB4_YEAST Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE1 PE=1 SV=2
7	Q09720	1.28e-59	187	194	0.438	0.454	PSB4_SCHPO Probable proteasome subunit beta type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC31A2.04c PE=3 SV=1
8	O23714	8.73e-58	182	204	0.433	0.426	PSB2A_ARATH Proteasome subunit beta type-2-A OS=Arabidopsis thaliana OX=3702 GN=PBD1 PE=1 SV=1
9	F4JIF9	8.25e-54	172	215	0.428	0.400	F4JIF9_ARATH Proteasome subunit beta OS=Arabidopsis thaliana OX=3702 GN=PBD2 PE=1 SV=1
10	Q55DY7	3.26e-50	163	198	0.418	0.424	PSB2_DICDI Proteasome subunit beta type-2 OS=Dictyostelium discoideum OX=44689 GN=psmB2 PE=3 SV=1
11	Q9NHC6	3.98e-41	140	206	0.373	0.364	PSB2_TRYBB Proteasome subunit beta type-2 OS=Trypanosoma brucei brucei OX=5702 GN=PSB4 PE=2 SV=1
12	Q58634	2.23e-15	73.6	224	0.254	0.228	PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=psmB PE=1 SV=1
13	A0A140VK45	3.21e-12	65.5	241	0.244	0.203	A0A140VK45_HUMAN Proteasome subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
14	P20618	3.21e-12	65.5	241	0.244	0.203	PSB1_HUMAN Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2
15	Q6LZD4	4.47e-12	64.7	219	0.219	0.201	PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=psmB PE=1 SV=1
16	O43063	6.06e-12	64.3	226	0.214	0.190	PSB1_SCHPO Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pre3 PE=3 SV=1
17	O09061	1.56e-11	63.5	240	0.239	0.200	PSB1_MOUSE Proteasome subunit beta type-1 OS=Mus musculus OX=10090 GN=Psmb1 PE=1 SV=1
18	P34286	3.14e-11	62.8	258	0.224	0.174	PSB1_CAEEL Proteasome subunit beta type-1 OS=Caenorhabditis elegans OX=6239 GN=pbs-6 PE=1 SV=2
19	Q86A21	5.83e-11	62.0	236	0.209	0.178	PSB1_DICDI Proteasome subunit beta type-1 OS=Dictyostelium discoideum OX=44689 GN=psmB1 PE=3 SV=1
20	Q9P996	6.64e-11	61.2	213	0.234	0.221	PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=psmB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00227 Proteasome	8.9e-38	141.2	Proteasome subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000013474

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000338	0.999	Proteasome (prosome, macropain) subunit, beta type, 1
2	61853.ENSNLEP00000000693	0.999	Proteasome (prosome, macropain) subunit, beta type, 3
3	61853.ENSNLEP00000001603	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
4	61853.ENSNLEP00000002428	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
5	61853.ENSNLEP00000003464	0.999	Proteasome (prosome, macropain) subunit, alpha type, 5
6	61853.ENSNLEP00000004474	0.999	Proteasome (prosome, macropain) subunit, alpha type, 6
7	61853.ENSNLEP00000005055	0.999	Proteasome (prosome, macropain) 26S subunit, ATPase, 5
8	61853.ENSNLEP00000006801	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
9	61853.ENSNLEP00000008201	0.999	Proteasome (prosome, macropain) subunit, beta type, 8
10	61853.ENSNLEP00000008235	0.999	Proteasome (prosome, macropain) subunit, beta type, 9
11	61853.ENSNLEP00000011332	0.999	Proteasome (prosome, macropain) 26S subunit, ATPase, 2
12	61853.ENSNLEP00000012370	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
13	61853.ENSNLEP00000012443	0.999	Proteasome (prosome, macropain) subunit, beta type, 4
14	61853.ENSNLEP00000014388	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
15	61853.ENSNLEP00000015275	0.999	Proteasome (prosome, macropain) 26S subunit, ATPase, 6
16	61853.ENSNLEP00000015936	0.999	Proteasome (prosome, macropain) subunit, alpha type, 3
17	61853.ENSNLEP00000017031	0.999	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
18	61853.ENSNLEP00000017278	0.999	Proteasome (prosome, macropain) 26S subunit, ATPase, 4
19	61853.ENSNLEP00000017781	0.999	Proteasome (prosome, macropain) 26S subunit, ATPase, 3
20	61853.ENSNLEP00000018121	0.999	Proteasome (prosome, macropain) subunit, beta type, 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.704	catalytic activity, acting on a protein
GO:0016787	0.604	hydrolase activity
GO:0008233	0.564	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.917	organic substance metabolic process
GO:0050896	0.854	response to stimulus
GO:0019538	0.836	protein metabolic process
GO:0042221	0.817	response to chemical
GO:1901698	0.782	response to nitrogen compound
GO:0009987	0.632	cellular process
GO:0010033	0.593	response to organic substance
GO:0014070	0.521	response to organic cyclic compound
GO:0010243	0.520	response to organonitrogen compound
GO:0044237	0.353	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0000502	0.996	proteasome complex
GO:0005839	0.978	proteasome core complex
GO:0065010	0.759	extracellular membrane-bounded organelle
GO:0070062	0.749	extracellular exosome
GO:0016020	0.568	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.604	Hydrolases.
EC:3.4.-.-	0.564	Acting on peptide bonds (peptidases).

[back to server]