StarFunc result for job id P49748

User Input

>input (655 residues)
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDAL
TRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPA
KNDALEMVEETTWQGLKELGAFGLQVPSELGGVGLCNTQYARLVEIVGMHDLGVGITLGA
HQSIGFKGILLFGTKAQKEKYLPKLASGETVAAFCLTEPSSGSDAASIRTSAVPSPCGKY
YTLNGSKLWISNGGLADIFTVFAKTPVTDPATGAVKEKITAFVVERGFGGITHGPPEKKM
GIKASNTAEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAV
DHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKI
FGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVALQGCMDK
GKELSGLGSALKNPFGNAGLLLGEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRAL
EQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEK
MLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49748	1.000	1.000	9.263E-94	655	1.000	1.000	P49748.pdb.gz	ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1
2	AFDB:P50544	0.910	0.908	3.359E-81	656	0.831	0.829	P50544.pdb.gz	ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadvl PE=1 SV=3
3	PDB:7s7gA	0.865	0.991	4.905E-78	571	0.872	1.000	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
4	AFDB:A9JT52	0.900	0.895	4.264E-73	659	0.689	0.684	A9JT52.pdb.gz
5	AFDB:Q8JZN5	0.857	0.897	1.318E-51	625	0.434	0.454	Q8JZN5.pdb.gz	ACAD9_MOUSE Complex I assembly factor ACAD9, mitochondrial OS=Mus musculus OX=10090 GN=Acad9 PE=1 SV=2
6	AFDB:Q9H845	0.847	0.892	1.864E-51	621	0.427	0.451	Q9H845.pdb.gz	ACAD9_HUMAN Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
7	AFDB:P9WQF7	0.779	0.784	1.298E-33	650	0.267	0.269	P9WQF7.pdb.gz	Y873_MYCTU Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE10 PE=1 SV=1
8	AFDB:Q5U117	0.802	0.821	9.281E-30	639	0.234	0.239	Q5U117.pdb.gz	Q5U117_DROME Enigma OS=Drosophila melanogaster OX=7227 GN=Egm PE=1 SV=1
9	AFDB:Q9UKU7	0.533	0.828	1.470E-27	415	0.195	0.308	Q9UKU7.pdb.gz	ACAD8_HUMAN Isobutyryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD8 PE=1 SV=1
10	AFDB:Q9D7B6	0.532	0.831	1.032E-26	413	0.192	0.305	Q9D7B6.pdb.gz	ACAD8_MOUSE Isobutyryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acad8 PE=1 SV=2
11	AFDB:P70584	0.541	0.810	1.281E-26	432	0.215	0.326	P70584.pdb.gz	ACDSB_RAT Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadsb PE=1 SV=1
12	PDB:1jqiA	0.536	0.902	3.084E-26	384	0.205	0.349	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
13	PDB:1rx0A	0.532	0.890	2.260E-25	384	0.182	0.310	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
14	PDB:6fahC	0.536	0.910	3.638E-25	379	0.186	0.322	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
15	PDB:1ivhA	0.528	0.880	6.965E-25	387	0.191	0.323	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
16	PDB:2a1tC	0.542	0.900	1.381E-23	388	0.200	0.338	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
17	PDB:2r0mA	0.531	0.876	2.883E-23	390	0.165	0.277	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
18	PDB:2ix6A	0.526	0.809	4.808E-22	416	0.160	0.252	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
19	PDB:6af6A	0.532	0.895	3.373E-21	383	0.162	0.277	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
20	PDB:6kseA	0.618	0.663	4.303E-19	607	0.166	0.180	6kseA.pdb.gz	Structural basis for the broad substrate specificity of two acyl-CoA dehydrogenases FadE5 from mycobacteria.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P45953	0.0	1162	655	0.852	0.852	ACADV_RAT Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acadvl PE=1 SV=1
2	P49748	0.0	1340	655	1.000	1.000	ACADV_HUMAN Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1
3	P50544	0.0	1146	656	0.843	0.841	ACADV_MOUSE Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadvl PE=1 SV=3
4	Q7T2C2	0.0	943	659	0.692	0.687	Q7T2C2_DANRE Acyl-Coenzyme A dehydrogenase, very long chain OS=Danio rerio OX=7955 GN=fb52d04 PE=1 SV=1
5	Q8JZN5	2.25e-180	528	625	0.437	0.458	ACAD9_MOUSE Complex I assembly factor ACAD9, mitochondrial OS=Mus musculus OX=10090 GN=Acad9 PE=1 SV=2
6	Q9H845	2.39e-178	522	621	0.421	0.444	ACAD9_HUMAN Complex I assembly factor ACAD9, mitochondrial OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
7	Q9H9W4	7.95e-155	457	498	0.368	0.484	Q9H9W4_HUMAN Acyl-CoA dehydrogenase family member 9 OS=Homo sapiens OX=9606 GN=ACAD9 PE=1 SV=1
8	P9WQF7	4.12e-69	239	650	0.266	0.268	Y873_MYCTU Probable acyl-CoA dehydrogenase FadE10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE10 PE=1 SV=1
9	Q95U46	1.77e-65	223	414	0.203	0.321	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
10	Q9VVU1	2.95e-65	223	414	0.203	0.321	Q9VVU1_DROME FI09602p OS=Drosophila melanogaster OX=7227 GN=GH07925p PE=1 SV=1
11	P9WQG1	1.75e-63	217	389	0.191	0.321	ACDP_MYCTU Probable acyl-CoA dehydrogenase FadE25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadE25 PE=1 SV=1
12	Q9JHI5	9.15e-63	216	424	0.203	0.314	IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ivd PE=1 SV=1
13	P15651	2.63e-62	214	412	0.208	0.330	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
14	C8VQF1	3.12e-62	215	439	0.203	0.303	C8VQF1_EMENI Acyl-CoA dehydrogenase, putative (AFU_orthologue AFUA_1G14850) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00824 PE=3 SV=1
15	Q07417	3.59e-62	214	412	0.208	0.330	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
16	G3KIM8	5.29e-62	213	394	0.202	0.335	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
17	Q9I296	5.64e-62	213	387	0.186	0.315	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
18	P12007	9.58e-62	213	424	0.202	0.311	IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ivd PE=1 SV=2
19	H2KZG6	1.81e-61	213	427	0.189	0.290	H2KZG6_CAEEL Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acdh-1 PE=1 SV=1
20	E5KSD5	1.84e-61	212	412	0.192	0.306	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	3.2e-38	142.8	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	6e-10	50.9	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	1.3e-19	81.5	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	1.3e-20	85.5	Acyl-CoA dehydrogenase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006616

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000028092	0.998	Uncharacterized protein
2	9593.ENSGGOP00000023814	0.997	Uncharacterized protein
3	9593.ENSGGOP00000003758	0.988	acetyl-CoA acyltransferase 1
4	9593.ENSGGOP00000007534	0.986	Belongs to the enoyl-CoA hydratase/isomerase family.
5	9593.ENSGGOP00000012250	0.985	acetyl-CoA acyltransferase 2
6	9593.ENSGGOP00000003947	0.978	Carnitine palmitoyltransferase 2
7	9593.ENSGGOP00000004627	0.974	Uncharacterized protein
8	9593.ENSGGOP00000026247	0.963	acyl-CoA synthetase bubblegum family member 2
9	9593.ENSGGOP00000002205	0.959	acyl-CoA synthetase bubblegum family member 1
10	9593.ENSGGOP00000006400	0.933	acyl-CoA dehydrogenase, long chain
11	9593.ENSGGOP00000005959	0.931	Solute carrier family 27 (fatty acid transporter), member 2
12	9593.ENSGGOP00000004511	0.926	acyl-CoA synthetase long-chain family member 5
13	9593.ENSGGOP00000002638	0.922	acyl-CoA synthetase long-chain family member 3
14	9593.ENSGGOP00000005351	0.919	ECSIT signalling integrator
15	9593.ENSGGOP00000016487	0.910	acyl-CoA synthetase long-chain family member 6
16	9593.ENSGGOP00000013915	0.905	enoyl-CoA delta isomerase 1
17	9593.ENSGGOP00000004501	0.904	Belongs to the acyl-CoA oxidase family.
18	9593.ENSGGOP00000008424	0.904	acyl-CoA synthetase long-chain family member 4
19	9593.ENSGGOP00000017201	0.902	Chaperone protein involved in early stages of the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I).
20	9593.ENSGGOP00000020623	0.898	Solute carrier family 27 (fatty acid transporter), member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003995	0.999	acyl-CoA dehydrogenase activity
GO:0050660	0.999	flavin adenine dinucleotide binding
GO:0042802	0.908	identical protein binding
GO:0004466	0.506	long-chain-acyl-CoA dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0009056	0.994	catabolic process
GO:0044255	0.992	cellular lipid metabolic process
GO:0006631	0.983	fatty acid metabolic process
GO:0046395	0.978	carboxylic acid catabolic process
GO:0009062	0.973	fatty acid catabolic process
GO:0019395	0.969	fatty acid oxidation
GO:0006635	0.954	fatty acid beta-oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0016020	0.993	membrane
GO:0031090	0.961	organelle membrane
GO:0031966	0.954	mitochondrial membrane
GO:0005634	0.870	nucleus
GO:0005759	0.815	mitochondrial matrix
GO:0005743	0.787	mitochondrial inner membrane
GO:0031981	0.657	nuclear lumen
GO:0043228	0.453	non-membrane-bounded organelle
GO:0043232	0.403	intracellular non-membrane-bounded organelle
GO:0032991	0.300	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.999	Acting on the CH-CH group of donors.
RHEA:17721	0.506	a long-chain 2,3-saturated fatty acyl-CoA + H(+) + oxidized [electron-transfer flavoprotein] = a long-chain (2E)-enoyl-CoA + reduced [electron-transfer flavoprotein]
EC:1.3.8.8	0.506	long-chain-acyl-CoA dehydrogenase.

[back to server]