StarFunc result for job id P49750

User Input

>input (2146 residues)
MYPNWGRYGGSSHYPPPPVPPPPPVALPEASPGPGYSSSTTPAAPSSSGFMSFREQHLAQ
LQQLQQMHQKQMQCVLQPHHLPPPPLPPPPVMPGGGYGDWQPPPPPMPPPPGPALSYQKQ
QQYKHQMLHHQRDGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPPPQPPPSYYPPTSS
QPYLPPAQPSPSQSPPSQSYLAPTPSYSSSSSSSQSYLSHSQSYLPSSQASPSRPSQGHS
KSQLLAPPPPSAPPGNKTTVQQEPLESGAKNKSTEQQQAAPEPDPSTMTPQEQQQYWYRQ
HLLSLQQRTKVHLPGHKKGPVVAKDTPEPVKEEVTVPATSQVPESPSSEEPPLPPPNEEV
PPPLPPEEPQSEDPEEDARLKQLQAAAAHWQQHQQHRVGFQYQGIMQKHTQLQQILQQYQ
QIIQPPPHIQTMSVDMQLRHYEMQQQQFQHLYQEWEREFQLWEEQLHSYPHKDQLQEYEK
QWKTWQGHMKATQSYLQEKVNSFQNMKNQYMGNMSMPPPFVPYSQMPPPLPTMPPPVLPP
SLPPPVMPPALPATVPPPGMPPPVMPPSLPTSVPPPGMPPSLSSAGPPPVLPPPSLSSAG
PPPVLPPPSLSSTAPPPVMPLPPLSSATPPPGIPPPGVPQGIPPQLTAAPVPPASSSQSS
QVPEKPRPALLPTPVSFGSAPPTTYHPPLQSAGPSEQVNSKAPLSKSALPYSSFSSDQGL
GESSAAPSQPITAVKDMPVRSGGLLPDPPRSSYLESPRGPRFDGPRRFEDLGSRCEGPRP
KGPRFEGNRPDGPRPRYEGHPAEGTKSKWGMIPRGPASQFYITPSTSLSPRQSGPQWKGP
KPAFGQQHQQQPKSQAEPLSGNKEPLADTSSNQQKNFKMQSAAFSIAADVKDVKAAQSNE
NLSDSQQEPPKSEVSEGPVEPSNWDQNVQSMETQIDKAQAVTQPVPLANKPVPAQSTFPS
KTGGMEGGTAVATSSLTADNDFKPVGIGLPHSENNQDKGLPRPDNRDNRLEGNRGNSSSY
RGPGQSRMEDTRDKGLVNRGRGQAISRGPGLVKQEDFRDKMMGRREDSREKMNRGEGSRD
RGLVRPGSSREKVPGGLQGSQDRGAAGSRERGPPRRAGSQERGPLRRAGSRERIPPRRAG
SRERGPPRGPGSRERGLGRSDFGRDRGPFRPEPGDGGEKMYPYHRDEPPRAPWNHGEERG
HEEFPLDGRNAPMERERLDDWDRERYWRECERDYQDDTLELYNREDRFSAPPSRSHDGDR
RGPWWDDWERDQDMDEDYNREMERDMDRDVDRISRPMDMYDRSLDNEWDRDYGRPLDEQE
SQFRERDIPSLPPLPPLPPLPPLDRYRDDRWREERNREHGYDRDFRDRGELRIREYPERG
DTWREKRDYVPDRMDWERERLSDRWYPSDVDRHSPMAEHMPSSHHSSEMMGSDASLDSDQ
GLGGVMVLSQRQHEIILKAAQELKMLREQKEQLQKMKDFGSEPQMADHLPPQESRLQNTS
SRPGMYPPPGSYRPPPPMGKPPGSIVRPSAPPARSSVPVTRPPVPIPPPPPPPPLPPPPP
VIKPQTSAVEQERWDEDSFYGLWDTNDEQGLNSEFKSETAAIPSAPVLPPPPVHSSIPPP
GPVPMGMPPMSKPPPVQQTVDYGHGRDISTNKVEQIPYGERITLRPDPLPERSTFETEHA
GQRDRYDRERDREPYFDRQSNVIADHRDFKRDRETHRDRDRDRGVIDYDRDRFDRERRPR
DDRAQSYRDKKDHSSSRRGGFDRPSYDRKSDRPVYEGPSMFGGERRTYPEERMPLPAPSL
SHQPPPAPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKLIRDKEVE
FGGPAPRVLSLDDYFITEVEKEEKDPDSGKKVKKKVMEYEYEAEMEETYRTSMFKTFKKT
LDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIHGRKLKEI
NKMADHWETAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEEQKEEKKDAEEEESELGYI
PKSKWEMDTSEAKLDKLDGLRTGTKRKRDWEAIASRMEDYLQLPDDYDTRASEPGKKRVR
WADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAEKALNRTKYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49750	1.000	1.000	0.000	2146	1.000	1.000	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
2	AFDB:M9NGY4	0.102	0.115	1.734E-33	1885	0.171	0.194	M9NGY4.pdb.gz	M9NGY4_DROME ZAP3, isoform E OS=Drosophila melanogaster OX=7227 GN=ZAP3 PE=1 SV=1
3	PDB:2axnA	0.063	0.275	3.285E-7	451	0.013	0.062	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
4	PDB:1k6mA	0.062	0.277	5.300E-7	432	0.015	0.074	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
5	PDB:1bifA	0.062	0.274	7.587E-7	432	0.014	0.067	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
6	AFDB:P18160	0.038	0.034	2.376E-6	2410	0.132	0.117	P18160.pdb.gz	SPLA_DICDI Dual specificity protein kinase splA OS=Dictyostelium discoideum OX=44689 GN=splA PE=1 SV=3
7	PDB:5htkA	0.060	0.276	5.458E-6	425	0.014	0.068	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
8	PDB:2ia5H	0.059	0.381	4.168E-5	301	0.014	0.103	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
9	AFDB:Q9VUB7	0.043	0.041	8.090E-5	2294	0.125	0.117	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
10	AFDB:P35658	0.031	0.032	1.158E-4	2090	0.121	0.124	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
11	PDB:1tevA	0.052	0.477	2.095E-4	194	0.014	0.149	1tevA.pdb.gz
12	PDB:1ko5A	0.059	0.567	2.224E-4	172	0.008	0.099	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
13	PDB:1xjqB	0.058	0.195	2.506E-4	590	0.014	0.051	1xjqB.pdb.gz	The crystal structure of human PAPS synthetase 1 reveals asymmetry in substrate binding
14	AFDB:Q80U93	0.032	0.032	3.398E-4	2085	0.125	0.129	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
15	PDB:2p0eA	0.058	0.484	4.557E-4	190	0.015	0.174	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
16	AFDB:F1QXN5	0.038	0.052	4.864E-4	1416	0.080	0.121	F1QXN5.pdb.gz
17	PDB:2cdnA	0.057	0.498	5.452E-4	186	0.014	0.167	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
18	AFDB:Q5T5P2	0.040	0.043	5.820E-4	1943	0.127	0.140	Q5T5P2.pdb.gz	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
19	AFDB:A2AQ25	0.042	0.046	4.718E-3	1946	0.126	0.139	A2AQ25.pdb.gz	SKT_MOUSE Sickle tail protein OS=Mus musculus OX=10090 GN=Skt PE=1 SV=1
20	AFDB:Q54KI4	0.032	0.053	5.009E-3	1196	0.067	0.120	Q54KI4.pdb.gz	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CB49	0.0	1039	1376	0.294	0.459	YLPM1_RAT YLP motif-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ylpm1 PE=1 SV=1
2	P49750	0.0	4291	2146	1.000	1.000	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
3	Q9R0I7	0.0	1016	1386	0.295	0.457	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
4	M9NGY4	3.33e-78	291	1885	0.068	0.078	M9NGY4_DROME ZAP3, isoform E OS=Drosophila melanogaster OX=7227 GN=ZAP3 PE=1 SV=1
5	Q9W2Y5	3.33e-78	291	1884	0.068	0.078	Q9W2Y5_DROME ZAP3, isoform C OS=Drosophila melanogaster OX=7227 GN=ZAP3 PE=1 SV=2
6	M9PCJ6	1.19e-06	57.0	18641	0.026	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PC48	1.23e-06	56.6	18095	0.026	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	Q9SKI0	8.91e-04	45.8	291	0.025	0.186	Q9SKI0_ARATH At2g10940/F15K19.1 OS=Arabidopsis thaliana OX=3702 GN=At2g10940 PE=1 SV=1
9	G5EEL0	0.002	45.8	592	0.023	0.084	LIDB1_CAEEL LIM domain-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ldb-1 PE=1 SV=1
10	Q9U3E2	0.002	45.8	629	0.023	0.079	Q9U3E2_CAEEL LIM interaction domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ldb-1 PE=1 SV=1
11	O14776	0.004	45.1	1098	0.020	0.039	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
12	E9PEZ7	0.87	37.0	458	0.014	0.066	E9PEZ7_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
13	A0A0C4DG21	1.1	36.6	507	0.014	0.059	A0A0C4DG21_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
14	E7EP65	1.2	36.6	486	0.014	0.062	E7EP65_HUMAN Abl interactor 2 (Fragment) OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=1
15	F8WAL6	2.0	35.8	542	0.014	0.055	F8WAL6_HUMAN Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2 PE=1 SV=3
16	Q8CGF7	5.5	34.7	1100	0.020	0.039	TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus OX=10090 GN=Tcerg1 PE=1 SV=2
17	P19835	9.7	33.9	753	0.023	0.066	CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens OX=9606 GN=CEL PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	1.5	19.6	6-phosphofructo-2-kinase
2	PF13207 AAA_17	2.9e+02	13.3	AAA domain
3	PF13238 AAA_18	55	15.7	AAA domain
4	PF13671 AAA_33	1.8e-05	36.4	AAA domain
5	PF08433 KTI12	15	16.5	Chromatin associated protein KTI12
6	PF06414 Zeta_toxin	95	13.8	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324463

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.899	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000326031	0.858	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000170150	0.767	BPI fold containing family B member 2
4	9606.ENSP00000267064	0.721	SWI/SNF complex subunit SMARCC2
5	9606.ENSP00000274008	0.708	Spermatogenesis-associated protein 5
6	9606.ENSP00000477538	0.694	Nucleosome assembly protein 1-like 1
7	9606.ENSP00000380033	0.686	Probable ATP-dependent RNA helicase DDX17
8	9606.ENSP00000318861	0.683	Splicing factor 3B subunit 2
9	9606.ENSP00000301904	0.681	Scavenger receptor class A member 3
10	9606.ENSP00000355541	0.635	HEAT repeat-containing protein 1
11	9606.ENSP00000254480	0.627	SWI/SNF complex subunit SMARCC1
12	9606.ENSP00000459615	0.597	SLIT-ROBO Rho GTPase-activating protein 2
13	9606.ENSP00000478874	0.576	Calcium/calmodulin-dependent protein kinase type 1D
14	9606.ENSP00000331474	0.554	Synapse differentiation-inducing gene protein 1-like
15	9606.ENSP00000380131	0.551	Claudin-6
16	9606.ENSP00000290231	0.532	Nuclear receptor coactivator 5
17	9606.ENSP00000331369	0.525	BolA-like protein 3
18	9606.ENSP00000394863	0.515	Palmitoyl-protein thioesterase 1
19	9606.ENSP00000306099	0.513	Fibrinogen beta chain
20	9606.ENSP00000419184	0.505	Histone-lysine N-methyltransferase SMYD3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010556	0.992	regulation of macromolecule biosynthetic process
GO:0031326	0.992	regulation of cellular biosynthetic process
GO:0051252	0.992	regulation of RNA metabolic process
GO:0048519	0.987	negative regulation of biological process
GO:0048523	0.984	negative regulation of cellular process
GO:2001141	0.984	regulation of RNA biosynthetic process
GO:0051172	0.967	negative regulation of nitrogen compound metabolic process
GO:0051128	0.939	regulation of cellular component organization
GO:0031324	0.910	negative regulation of cellular metabolic process
GO:0010468	0.904	regulation of gene expression
GO:0045934	0.870	negative regulation of nucleobase-containing compound metabolic process
GO:0009987	0.831	cellular process
GO:0006355	0.687	regulation of DNA-templated transcription
GO:0010605	0.686	negative regulation of macromolecule metabolic process
GO:0031327	0.656	negative regulation of cellular biosynthetic process
GO:0006357	0.635	regulation of transcription by RNA polymerase II
GO:0010558	0.628	negative regulation of macromolecule biosynthetic process
GO:1902679	0.577	negative regulation of RNA biosynthetic process
GO:0033044	0.548	regulation of chromosome organization
GO:1903507	0.514	negative regulation of nucleic acid-templated transcription
GO:0045892	0.458	negative regulation of DNA-templated transcription
GO:0051052	0.431	regulation of DNA metabolic process
GO:0032204	0.416	regulation of telomere maintenance
GO:0000122	0.409	negative regulation of transcription by RNA polymerase II
GO:0071840	0.387	cellular component organization or biogenesis
GO:0048518	0.360	positive regulation of biological process
GO:0016043	0.332	cellular component organization
GO:0048522	0.323	positive regulation of cellular process
GO:0008152	0.307	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016604	0.990	nuclear body
GO:0016607	0.979	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]