StarFunc result for job id P49753

User Input

>input (483 residues)
MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVP
ARMAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLG
ELDLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRTPLAVELEVLDGHDPDPGR
LLCQTRHERYFLPPGVRREPVRVGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLL
AGKGFAVMALAYYNYEDLPKTMETLHLEYFEEAMNYLLSHPEVKGPGVGLLGISKGGELC
LSMASFLKGITAAVVINGSVANVGGTLHYKGETLPPVGVNRNRIKVTKDGYADIVDVLNS
PLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPET
GHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWKQLQTFFHKHLGGHEGTIP
SKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49753	1.000	1.000	0.000	483	1.000	1.000	P49753.pdb.gz	ACOT2_HUMAN Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT2 PE=1 SV=6
2	PDB:3hlkB	0.847	0.995	1.334E-89	411	0.845	0.993	3hlkB.pdb.gz
3	AFDB:O55137	0.846	0.975	1.246E-82	419	0.665	0.766	O55137.pdb.gz	ACOT1_MOUSE Acyl-coenzyme A thioesterase 1 OS=Mus musculus OX=10090 GN=Acot1 PE=1 SV=1
4	AFDB:Q9QYR7	0.859	0.960	1.573E-81	432	0.669	0.748	Q9QYR7.pdb.gz	ACOT3_MOUSE Acyl-coenzyme A thioesterase 3 OS=Mus musculus OX=10090 GN=Acot3 PE=1 SV=1
5	AFDB:O55171	0.847	0.902	4.700E-81	453	0.698	0.744	O55171.pdb.gz	ACOT2_RAT Acyl-coenzyme A thioesterase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acot2 PE=1 SV=1
6	AFDB:Q6Q2Z6	0.850	0.975	4.700E-81	421	0.644	0.739	Q6Q2Z6.pdb.gz	ACOT5_MOUSE Acyl-coenzyme A thioesterase 5 OS=Mus musculus OX=10090 GN=Acot5 PE=1 SV=2
7	AFDB:Q8N9L9	0.856	0.982	4.732E-78	421	0.611	0.701	Q8N9L9.pdb.gz	ACOT4_HUMAN Peroxisomal succinyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT4 PE=1 SV=2
8	AFDB:Q8BWN8	0.851	0.975	2.690E-73	421	0.538	0.618	Q8BWN8.pdb.gz	ACOT4_MOUSE Peroxisomal succinyl-coenzyme A thioesterase OS=Mus musculus OX=10090 GN=Acot4 PE=1 SV=1
9	PDB:3k2iA	0.820	0.977	1.389E-71	405	0.586	0.699	3k2iA.pdb.gz
10	AFDB:Q32Q92	0.838	0.965	3.410E-70	419	0.545	0.628	Q32Q92.pdb.gz	ACOT6_MOUSE Acyl-coenzyme A thioesterase 6 OS=Mus musculus OX=10090 GN=Acot6 PE=1 SV=1
11	AFDB:A2AKK5	0.811	0.939	1.660E-57	416	0.383	0.445	A2AKK5.pdb.gz	ACNT1_MOUSE Acyl-coenzyme A amino acid N-acyltransferase 1 OS=Mus musculus OX=10090 GN=Acnat1 PE=1 SV=1
12	AFDB:Q91X34	0.809	0.928	1.660E-57	420	0.395	0.455	Q91X34.pdb.gz	BAAT_MOUSE Bile acid-CoA:amino acid N-acyltransferase OS=Mus musculus OX=10090 GN=Baat PE=1 SV=1
13	PDB:7jn7A	0.365	0.225	4.510E-9	846	0.141	0.080	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
14	PDB:2gbfA	0.369	0.254	8.500E-9	730	0.110	0.073	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
15	PDB:4n8eB	0.360	0.248	1.348E-8	734	0.106	0.069	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
16	PDB:4bp8A	0.386	0.276	4.028E-8	712	0.124	0.084	4bp8A.pdb.gz
17	PDB:6eorB	0.360	0.230	6.766E-8	805	0.139	0.083	6eorB.pdb.gz	Structures and mechanism of dipeptidyl peptidases 8 and 9, important players in cellular homeostasis and cancer.
18	PDB:3m83A	0.328	0.466	9.025E-8	325	0.116	0.172	3m83A.pdb.gz	Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
19	PDB:5l2pA	0.331	0.488	1.013E-7	306	0.101	0.160	5l2pA.pdb.gz
20	PDB:6y0fC	0.378	0.263	1.909E-7	722	0.104	0.069	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O55137	0.0	670	419	0.663	0.764	ACOT1_MOUSE Acyl-coenzyme A thioesterase 1 OS=Mus musculus OX=10090 GN=Acot1 PE=1 SV=1
2	O55171	0.0	684	453	0.698	0.744	ACOT2_RAT Acyl-coenzyme A thioesterase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acot2 PE=1 SV=1
3	O88267	0.0	668	419	0.665	0.766	ACOT1_RAT Acyl-coenzyme A thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Acot1 PE=1 SV=1
4	P49753	0.0	986	483	1.000	1.000	ACOT2_HUMAN Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT2 PE=1 SV=6
5	Q32Q92	0.0	543	419	0.545	0.628	ACOT6_MOUSE Acyl-coenzyme A thioesterase 6 OS=Mus musculus OX=10090 GN=Acot6 PE=1 SV=1
6	Q3I5F7	0.0	614	421	0.598	0.686	ACOT6_HUMAN Acyl-coenzyme A thioesterase 6 OS=Homo sapiens OX=9606 GN=ACOT6 PE=2 SV=2
7	Q6Q2Z6	0.0	654	421	0.644	0.739	ACOT5_MOUSE Acyl-coenzyme A thioesterase 5 OS=Mus musculus OX=10090 GN=Acot5 PE=1 SV=2
8	Q86TX2	0.0	852	421	0.861	0.988	ACOT1_HUMAN Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1
9	Q8BWN8	0.0	556	421	0.538	0.618	ACOT4_MOUSE Peroxisomal succinyl-coenzyme A thioesterase OS=Mus musculus OX=10090 GN=Acot4 PE=1 SV=1
10	Q8N9L9	0.0	569	421	0.611	0.701	ACOT4_HUMAN Peroxisomal succinyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT4 PE=1 SV=2
11	Q9QYR7	0.0	684	432	0.669	0.748	ACOT3_MOUSE Acyl-coenzyme A thioesterase 3 OS=Mus musculus OX=10090 GN=Acot3 PE=1 SV=1
12	Q9QYR9	0.0	691	453	0.704	0.751	ACOT2_MOUSE Acyl-coenzyme A thioesterase 2, mitochondrial OS=Mus musculus OX=10090 GN=Acot2 PE=1 SV=2
13	A2AKK5	1.05e-120	361	416	0.377	0.438	ACNT1_MOUSE Acyl-coenzyme A amino acid N-acyltransferase 1 OS=Mus musculus OX=10090 GN=Acnat1 PE=1 SV=1
14	Q91X34	9.55e-120	359	420	0.385	0.443	BAAT_MOUSE Bile acid-CoA:amino acid N-acyltransferase OS=Mus musculus OX=10090 GN=Baat PE=1 SV=1
15	Q63276	4.58e-118	354	420	0.381	0.438	BAAT_RAT Bile acid-CoA:amino acid N-acyltransferase OS=Rattus norvegicus OX=10116 GN=Baat PE=1 SV=2
16	Q14032	1.32e-105	322	418	0.381	0.440	BAAT_HUMAN Bile acid-CoA:amino acid N-acyltransferase OS=Homo sapiens OX=9606 GN=BAAT PE=1 SV=1
17	Q91VS8	0.17	37.0	1065	0.195	0.088	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
18	O86353	1.6	33.1	237	0.064	0.131	O86353_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2054 PE=1 SV=1
19	Q9SRX3	2.0	33.5	501	0.037	0.036	GUN1_ARATH Endoglucanase 1 OS=Arabidopsis thaliana OX=3702 GN=CEL2 PE=2 SV=1
20	O94887	3.9	32.7	1054	0.066	0.030	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08840 BAAT_C	2.7e-87	303.8	BAAT / Acyl-CoA thioester hydrolase C terminal
2	PF04775 Bile_Hydr_Trans	6.5e-35	131.3	Acyl-CoA thioester hydrolase/BAAT N-terminal region
3	PF01738 DLH	1.1	20.3	Dienelactone hydrolase family
4	PF03959 FSH1	4.5e+02	11.9	Serine hydrolase (FSH1)
5	PF00326 Peptidase_S9	3.3e+02	12.2	Prolyl oligopeptidase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217455	0.991	Acyl-coenzyme A thioesterase 8
2	9606.ENSP00000231887	0.960	Peroxisomal bifunctional enzyme
3	9606.ENSP00000221418	0.954	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
4	9606.ENSP00000293217	0.953	Peroxisomal acyl-coenzyme A oxidase 1
5	9606.ENSP00000369461	0.952	Enoyl-CoA delta isomerase 2, mitochondrial
6	9606.ENSP00000317721	0.946	Peroxisomal sarcosine oxidase
7	9606.ENSP00000371517	0.944	Alpha-methylacyl-CoA racemase
8	9606.ENSP00000363614	0.939	Hydroxymethylglutaryl-CoA lyase, mitochondrial
9	9606.ENSP00000413575	0.939	Peroxisomal carnitine O-octanoyltransferase
10	9606.ENSP00000262430	0.938	Malonyl-CoA decarboxylase, mitochondrial
11	9606.ENSP00000302620	0.938	Alanine-glyoxylate aminotransferase
12	9606.ENSP00000348775	0.936	Peroxisomal acyl-coenzyme A oxidase 3
13	9606.ENSP00000368066	0.934	Hydroxyacid oxidase 1
14	9606.ENSP00000315013	0.930	Carnitine O-acetyltransferase
15	9606.ENSP00000355607	0.930	Glyceronephosphate O-acyltransferase
16	9606.ENSP00000267842	0.928	Very long-chain acyl-CoA synthetase
17	9606.ENSP00000268533	0.928	Peroxisomal coenzyme A diphosphatase NUDT7
18	9606.ENSP00000285737	0.928	Lon protease homolog 2, peroxisomal
19	9606.ENSP00000431049	0.928	Soluble glutathione S-transferases
20	9606.ENSP00000323811	0.927	2-hydroxyacyl-CoA lyase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047617	1.000	acyl-CoA hydrolase activity
GO:0005515	0.975	protein binding
GO:0016740	0.506	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006629	0.992	lipid metabolic process
GO:0019752	0.992	carboxylic acid metabolic process
GO:1901360	0.990	organic cyclic compound metabolic process
GO:0032787	0.984	monocarboxylic acid metabolic process
GO:0044255	0.970	cellular lipid metabolic process
GO:0033875	0.941	ribonucleoside bisphosphate metabolic process
GO:0034032	0.941	purine nucleoside bisphosphate metabolic process
GO:0000038	0.937	very long-chain fatty acid metabolic process
GO:0006637	0.921	acyl-CoA metabolic process
GO:0001676	0.838	long-chain fatty acid metabolic process
GO:0009056	0.325	catabolic process
GO:0046395	0.317	carboxylic acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005829	0.993	cytosol
GO:0005739	0.987	mitochondrion
GO:0042579	0.969	microbody
GO:0005782	0.891	peroxisomal matrix
GO:0016020	0.557	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16781	1.000	a fatty acyl-CoA + H2O = a fatty acid + CoA + H(+)
EC:3.1.2.20	1.000	acyl-CoA hydrolase.
EC:2.-.-.-	0.506	Transferases.

[back to server]