StarFunc result for job id P49757

User Input

>input (651 residues)
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPS
SPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPMTKPVTVVAPQ
SPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPAS
PFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFG
TAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASA
DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QZS3	0.363	0.362	1.040E-90	653	0.937	0.934	Q9QZS3.pdb.gz	NUMB_MOUSE Protein numb homolog OS=Mus musculus OX=10090 GN=Numb PE=1 SV=1
2	AFDB:B3DG87	0.312	0.300	2.631E-64	680	0.648	0.621	B3DG87.pdb.gz
3	AFDB:B8A566	0.208	0.172	1.492E-11	797	0.192	0.157	B8A566.pdb.gz
4	AFDB:A0A024R036	0.210	0.181	7.579E-11	770	0.183	0.155	A0A024R036.pdb.gz
5	AFDB:O88797	0.209	0.179	1.869E-10	768	0.210	0.178	O88797.pdb.gz	DAB2_RAT Disabled homolog 2 OS=Rattus norvegicus OX=10116 GN=Dab2 PE=1 SV=1
6	AFDB:G3V874	0.114	0.081	1.732E-5	963	0.126	0.085	G3V874.pdb.gz	G3V874_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=1
7	AFDB:Q9VCX1	0.136	0.059	2.341E-5	1541	0.118	0.050	Q9VCX1.pdb.gz	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
8	PDB:5yqrA	0.090	0.205	1.679E-3	268	0.011	0.026	5yqrA.pdb.gz
9	AFDB:Q07436	0.114	0.056	1.680E-3	1427	0.127	0.058	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
10	AFDB:Q9DF49	0.161	0.103	2.720E-3	1074	0.114	0.069	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
11	AFDB:Q9V3V3	0.121	0.067	3.675E-3	1252	0.103	0.054	Q9V3V3.pdb.gz	Q9V3V3_DROME Pez, isoform A OS=Drosophila melanogaster OX=7227 GN=Pez PE=2 SV=1
12	PDB:7c3mA	0.105	0.118	6.705E-3	577	0.015	0.017	7c3mA.pdb.gz
13	PDB:4gouA	0.123	0.154	7.120E-3	507	0.015	0.020	4gouA.pdb.gz
14	PDB:4mk0A	0.114	0.117	9.059E-3	631	0.025	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:6r9tA	0.104	0.032	1.022E-2	2185	0.022	0.006	6r9tA.pdb.gz
16	PDB:4rm8A	0.107	0.180	1.224E-2	368	0.025	0.043	4rm8A.pdb.gz
17	PDB:3ljuX	0.139	0.227	2.373E-2	373	0.025	0.043	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
18	PDB:7r04B	0.106	0.033	2.373E-2	2229	0.020	0.006	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
19	PDB:7r03B	0.109	0.034	4.080E-2	2246	0.017	0.005	7r03B.pdb.gz
20	PDB:7nkyQ	0.090	0.140	4.333E-2	404	0.015	0.025	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IDU4	0.0	595	618	0.551	0.581	A0A0R4IDU4_DANRE NUMB-like endocytic adaptor protein OS=Danio rerio OX=7955 GN=z-numb PE=4 SV=1
2	A0A286Y8T8	0.0	597	640	0.551	0.561	A0A286Y8T8_DANRE NUMB-like endocytic adaptor protein OS=Danio rerio OX=7955 GN=z-numb PE=4 SV=1
3	A1L1I3	0.0	546	614	0.525	0.557	NUMBL_RAT Numb-like protein OS=Rattus norvegicus OX=10116 GN=Numbl PE=1 SV=1
4	F1RDZ7	0.0	697	669	0.631	0.614	F1RDZ7_DANRE NUMB endocytic adaptor protein OS=Danio rerio OX=7955 GN=numb PE=4 SV=1
5	O08919	0.0	531	604	0.510	0.550	NUMBL_MOUSE Numb-like protein OS=Mus musculus OX=10090 GN=Numbl PE=1 SV=3
6	P49757	0.0	1340	651	1.000	1.000	NUMB_HUMAN Protein numb homolog OS=Homo sapiens OX=9606 GN=NUMB PE=1 SV=2
7	Q1XD15	0.0	696	680	0.644	0.616	Q1XD15_DANRE Numb OS=Danio rerio OX=7955 GN=numb PE=2 SV=1
8	Q2LC84	0.0	1149	652	0.929	0.928	NUMB_RAT Protein numb homolog OS=Rattus norvegicus OX=10116 GN=Numb PE=1 SV=2
9	Q3MUI1	0.0	1011	592	0.845	0.929	Q3MUI1_RAT Numb OS=Rattus norvegicus OX=10116 GN=Numb PE=1 SV=1
10	Q9QZS3	0.0	1167	653	0.937	0.934	NUMB_MOUSE Protein numb homolog OS=Mus musculus OX=10090 GN=Numb PE=1 SV=1
11	B7Z5W0	1.24e-158	469	566	0.355	0.408	B7Z5W0_HUMAN cDNA FLJ53174, highly similar to Numb-like protein OS=Homo sapiens OX=9606 PE=1 SV=1
12	Q9Y6R0	6.99e-158	469	609	0.355	0.379	NUMBL_HUMAN Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1
13	P16554	7.68e-99	315	556	0.266	0.311	NUMB_DROME Protein numb OS=Drosophila melanogaster OX=7227 GN=numb PE=1 SV=2
14	F1LIN5	1.27e-62	219	535	0.207	0.252	F1LIN5_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
15	Q9XTY6	2.89e-62	219	593	0.207	0.228	NUMB1_CAEEL Numb-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
16	B5BM46	5.80e-61	218	682	0.207	0.198	B5BM46_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
17	Q9UBP9	5.10e-16	81.6	304	0.071	0.151	GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens OX=9606 GN=GULP1 PE=1 SV=1
18	Q5SW96	6.01e-13	72.4	308	0.075	0.159	ARH_HUMAN Low density lipoprotein receptor adapter protein 1 OS=Homo sapiens OX=9606 GN=LDLRAP1 PE=1 SV=3
19	Q8C142	2.40e-12	70.5	308	0.069	0.146	ARH_MOUSE Low density lipoprotein receptor adapter protein 1 OS=Mus musculus OX=10090 GN=Ldlrap1 PE=1 SV=3
20	D3ZAR1	5.70e-10	63.2	306	0.068	0.144	ARH_RAT Low density lipoprotein receptor adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Ldlrap1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06311 NumbF	4.1e-28	109.0	NUMB domain
2	PF00640 PID	8.8e-32	121.5	Phosphotyrosine interaction domain (PTB/PID)
3	PF14719 PID_2	0.48	21.8	Phosphotyrosine interaction domain (PTB/PID)
4	PF08416 PTB	0.33	22.4	Phosphotyrosine-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451300

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263925	0.999	E3 ubiquitin-protein ligase LNX
2	9606.ENSP00000277541	0.999	Neurogenic locus notch homolog protein 1
3	9606.ENSP00000258149	0.998	E3 ubiquitin-protein ligase Mdm2
4	9606.ENSP00000261769	0.997	Cadherin-1
5	9606.ENSP00000309539	0.997	Dihydropyrimidinase-related protein 2
6	9606.ENSP00000269305	0.996	Cellular tumor antigen p53
7	9606.ENSP00000360798	0.993	Epidermal growth factor receptor substrate 15
8	9606.ENSP00000480499	0.992	E3 ubiquitin-protein ligase Itchy homolog
9	9606.ENSP00000295797	0.991	Protein kinase C iota type
10	9606.ENSP00000367830	0.985	Protein kinase C zeta type
11	9606.ENSP00000344456	0.978	Catenin beta-1
12	9606.ENSP00000325929	0.973	Ligand of numb-protein X 2
13	9606.ENSP00000351926	0.966	AP-2 complex subunit alpha-1
14	9606.ENSP00000219255	0.958	Partitioning defective 6 homolog alpha
15	9606.ENSP00000256646	0.954	Neurogenic locus notch homolog protein 2
16	9606.ENSP00000263388	0.950	Neurogenic locus notch homolog protein 3
17	9606.ENSP00000327694	0.949	AP-2 complex subunit alpha-2
18	9606.ENSP00000362680	0.941	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000355777	0.936	Golgi resident protein GCP60
20	9606.ENSP00000304669	0.933	Catenin alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.941	cell adhesion molecule binding
GO:0045296	0.925	cadherin binding
GO:0008013	0.814	beta-catenin binding
GO:0045294	0.809	alpha-catenin binding
GO:0019899	0.371	enzyme binding
GO:0005102	0.300	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0048518	0.969	positive regulation of biological process
GO:0048522	0.954	positive regulation of cellular process
GO:0032879	0.939	regulation of localization
GO:0048519	0.906	negative regulation of biological process
GO:0032502	0.858	developmental process
GO:0032501	0.853	multicellular organismal process
GO:0048856	0.853	anatomical structure development
GO:0040012	0.850	regulation of locomotion
GO:0060341	0.837	regulation of cellular localization
GO:0048523	0.829	negative regulation of cellular process
GO:0007275	0.738	multicellular organism development
GO:0032880	0.735	regulation of protein localization
GO:1904375	0.684	regulation of protein localization to cell periphery
GO:0030154	0.640	cell differentiation
GO:0040017	0.603	positive regulation of locomotion
GO:0071840	0.544	cellular component organization or biogenesis
GO:0016043	0.507	cellular component organization
GO:0050896	0.474	response to stimulus
GO:1905475	0.467	regulation of protein localization to membrane
GO:0051128	0.321	regulation of cellular component organization
GO:0048583	0.312	regulation of response to stimulus
GO:0050793	0.305	regulation of developmental process
GO:0048513	0.304	animal organ development
GO:0048731	0.304	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0071944	0.996	cell periphery
GO:0043226	0.989	organelle
GO:0005886	0.987	plasma membrane
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0031982	0.887	vesicle
GO:0030054	0.758	cell junction
GO:0098590	0.721	plasma membrane region
GO:0097708	0.713	intracellular vesicle
GO:0031410	0.667	cytoplasmic vesicle
GO:0070013	0.612	intracellular organelle lumen
GO:0031981	0.598	nuclear lumen
GO:0016323	0.578	basolateral plasma membrane
GO:0005654	0.564	nucleoplasm
GO:0012505	0.518	endomembrane system
GO:0032991	0.515	protein-containing complex
GO:0005829	0.451	cytosol
GO:0005768	0.327	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]