StarFunc result for job id P49765

User Input

>input (207 residues)
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
STTSALTPGPAAAAADAAASSVAKGGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49765	1.000	1.000	2.126E-32	207	1.000	1.000	P49765.pdb.gz	VEGFB_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=2
2	AFDB:O35485	0.585	0.585	1.169E-26	207	0.870	0.870	O35485.pdb.gz	VEGFB_RAT Vascular endothelial growth factor B OS=Rattus norvegicus OX=10116 GN=Vegfb PE=2 SV=3
3	AFDB:E7EZR4	0.454	0.386	8.268E-13	246	0.309	0.260	E7EZR4.pdb.gz	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
4	AFDB:P15692	0.504	0.455	5.920E-12	232	0.314	0.280	P15692.pdb.gz	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
5	AFDB:O73682	0.444	0.485	2.703E-11	188	0.242	0.266	O73682.pdb.gz	VGFAA_DANRE Vascular endothelial growth factor A-A OS=Danio rerio OX=7955 GN=vegfaa PE=1 SV=1
6	AFDB:P15691	0.438	0.474	2.859E-11	190	0.256	0.279	P15691.pdb.gz	VEGFA_BOVIN Vascular endothelial growth factor A OS=Bos taurus OX=9913 GN=VEGFA PE=1 SV=1
7	AFDB:P67964	0.459	0.441	4.484E-11	216	0.246	0.236	P67964.pdb.gz	VEGFA_CHICK Vascular endothelial growth factor A OS=Gallus gallus OX=9031 GN=VEGFA PE=2 SV=1
8	AFDB:Q1ECU5	0.433	0.365	9.855E-11	250	0.227	0.188	Q1ECU5.pdb.gz
9	AFDB:P49763	0.455	0.430	1.830E-10	221	0.295	0.276	P49763.pdb.gz	PLGF_HUMAN Placenta growth factor OS=Homo sapiens OX=9606 GN=PGF PE=1 SV=2
10	AFDB:Q5RHW5	0.449	0.410	2.424E-10	228	0.184	0.167	Q5RHW5.pdb.gz
11	PDB:1wq8A	0.414	0.807	2.452E-9	100	0.193	0.400	1wq8A.pdb.gz
12	PDB:2k8pA	0.299	0.321	3.925E-3	189	0.121	0.132	2k8pA.pdb.gz
13	PDB:5vqfB	0.236	0.164	5.819E-3	320	0.072	0.047	5vqfB.pdb.gz
14	PDB:7ag0A	0.250	0.340	6.155E-3	140	0.077	0.114	7ag0A.pdb.gz
15	PDB:3rjrC	0.248	0.164	1.143E-2	343	0.082	0.050	3rjrC.pdb.gz
16	PDB:1m4uA	0.252	0.260	1.209E-2	199	0.087	0.090	1m4uA.pdb.gz
17	PDB:5ffoG	0.242	0.179	2.121E-2	297	0.072	0.051	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.242	0.177	2.374E-2	308	0.082	0.055	7y1rB.pdb.gz
19	PDB:4qhuC	0.228	0.331	5.838E-2	119	0.087	0.151	4qhuC.pdb.gz
20	PDB:7uwmA	0.220	0.341	6.176E-2	109	0.092	0.174	7uwmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49765	1.07e-147	410	207	1.000	1.000	VEGFB_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=2
2	Q7LAP4	1.07e-147	410	207	1.000	1.000	Q7LAP4_HUMAN Vascular endothelial growth factor B OS=Homo sapiens OX=9606 GN=VEGFB PE=1 SV=1
3	O35485	3.02e-109	313	207	0.792	0.792	VEGFB_RAT Vascular endothelial growth factor B OS=Rattus norvegicus OX=10116 GN=Vegfb PE=2 SV=3
4	P49766	1.17e-108	311	207	0.870	0.870	VEGFB_MOUSE Vascular endothelial growth factor B OS=Mus musculus OX=10090 GN=Vegfb PE=2 SV=2
5	P16612	4.85e-26	101	214	0.246	0.238	VEGFA_RAT Vascular endothelial growth factor A OS=Rattus norvegicus OX=10116 GN=Vegfa PE=1 SV=2
6	Q00731	8.71e-26	101	214	0.237	0.229	VEGFA_MOUSE Vascular endothelial growth factor A, long form OS=Mus musculus OX=10090 GN=Vegfa PE=1 SV=3
7	O73682	9.76e-26	100	188	0.242	0.266	VGFAA_DANRE Vascular endothelial growth factor A-A OS=Danio rerio OX=7955 GN=vegfaa PE=1 SV=1
8	Q9MYV3	1.21e-25	100	214	0.222	0.215	VEGFA_CANLF Vascular endothelial growth factor A OS=Canis lupus familiaris OX=9615 GN=VEGFA PE=1 SV=1
9	P15691	1.34e-25	100	190	0.237	0.258	VEGFA_BOVIN Vascular endothelial growth factor A OS=Bos taurus OX=9913 GN=VEGFA PE=1 SV=1
10	P15692	1.58e-25	100	232	0.232	0.207	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
11	E7EZR4	6.19e-24	97.1	246	0.217	0.183	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
12	P67863	2.24e-22	90.5	145	0.203	0.290	TXVE_VIPAA Snake venom vascular endothelial growth factor toxin vammin OS=Vipera ammodytes ammodytes OX=8705 PE=1 SV=2
13	P67964	2.51e-22	92.0	216	0.242	0.231	VEGFA_CHICK Vascular endothelial growth factor A OS=Gallus gallus OX=9031 GN=VEGFA PE=2 SV=1
14	P67965	2.51e-22	92.0	216	0.242	0.231	VEGFA_COTJA Vascular endothelial growth factor A OS=Coturnix japonica OX=93934 GN=VEGFA PE=2 SV=1
15	P83942	1.07e-21	87.4	110	0.188	0.355	TXVE_VIPAP Snake venom vascular endothelial growth factor toxin HF OS=Vipera aspis aspis OX=194601 PE=1 SV=1
16	Q330K6	1.19e-19	83.2	143	0.188	0.273	TXVE2_PROMU Snake venom vascular endothelial growth factor toxin OS=Protobothrops mucrosquamatus OX=103944 PE=1 SV=1
17	Q0QYI0	3.90e-18	80.5	194	0.193	0.206	Q0QYI0_DANRE Vascular endothelial growth factor A isoform 2 precursor (Fragment) OS=Danio rerio OX=7955 GN=fd42e02 PE=2 SV=1
18	Q63434	9.24e-16	73.6	158	0.246	0.323	PLGF_RAT Placenta growth factor OS=Rattus norvegicus OX=10116 GN=Pgf PE=1 SV=1
19	P49764	5.89e-15	71.2	158	0.222	0.291	PLGF_MOUSE Placenta growth factor OS=Mus musculus OX=10090 GN=Pgf PE=2 SV=1
20	P49763	8.61e-15	72.4	221	0.242	0.226	PLGF_HUMAN Placenta growth factor OS=Homo sapiens OX=9606 GN=PGF PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00341 PDGF	4e-19	80.0	PDGF/VEGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311127

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282397	0.999	Vascular endothelial growth factor receptor 1
2	9606.ENSP00000265371	0.984	Neuropilin-1
3	9606.ENSP00000263923	0.975	Vascular endothelial growth factor receptor 2
4	9606.ENSP00000261937	0.927	Vascular endothelial growth factor receptor 3
5	9606.ENSP00000274376	0.902	Ras GTPase-activating protein 1
6	9606.ENSP00000396896	0.893	DnaJ heat shock protein family member C4
7	9606.ENSP00000478570	0.844	Vascular endothelial growth factor A
8	9606.ENSP00000431418	0.825	High affinity nerve growth factor receptor
9	9606.ENSP00000369375	0.821	Angiopoietin-1 receptor
10	9606.ENSP00000422464	0.814	Platelet-derived growth factor C
11	9606.ENSP00000275493	0.759	Epidermal growth factor receptor
12	9606.ENSP00000261799	0.757	Platelet-derived growth factor receptor beta
13	9606.ENSP00000288135	0.754	Mast/stem cell growth factor receptor Kit
14	9606.ENSP00000393312	0.753	Fibroblast growth factor receptor 1
15	9606.ENSP00000286301	0.747	Macrophage colony-stimulating factor 1 receptor
16	9606.ENSP00000353582	0.730	Neuropilin-2
17	9606.ENSP00000294258	0.726	Zinc finger protein-like 1
18	9606.ENSP00000269571	0.725	Receptor tyrosine-protein kinase erbB-2
19	9606.ENSP00000410294	0.710	Fibroblast growth factor receptor 2
20	9606.ENSP00000317272	0.709	Hepatocyte growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.999	receptor ligand activity
GO:0070851	0.997	growth factor receptor binding
GO:0005126	0.996	cytokine receptor binding
GO:0005172	0.994	vascular endothelial growth factor receptor binding
GO:0042056	0.921	chemoattractant activity
GO:0042802	0.659	identical protein binding
GO:0043183	0.577	vascular endothelial growth factor receptor 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0050794	0.984	regulation of cellular process
GO:0032501	0.982	multicellular organismal process
GO:0048518	0.982	positive regulation of biological process
GO:0032502	0.976	developmental process
GO:0048856	0.962	anatomical structure development
GO:0019222	0.961	regulation of metabolic process
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0048519	0.948	negative regulation of biological process
GO:1902531	0.945	regulation of intracellular signal transduction
GO:0080090	0.944	regulation of primary metabolic process
GO:0051171	0.944	regulation of nitrogen compound metabolic process
GO:0048584	0.944	positive regulation of response to stimulus
GO:0031323	0.937	regulation of cellular metabolic process
GO:0048522	0.932	positive regulation of cellular process
GO:0043408	0.931	regulation of MAPK cascade
GO:0050678	0.929	regulation of epithelial cell proliferation
GO:0009987	0.924	cellular process
GO:0050896	0.923	response to stimulus
GO:0040012	0.918	regulation of locomotion
GO:0009967	0.915	positive regulation of signal transduction
GO:0051246	0.912	regulation of protein metabolic process
GO:0007275	0.910	multicellular organism development
GO:0043410	0.908	positive regulation of MAPK cascade
GO:0040017	0.906	positive regulation of locomotion
GO:0030334	0.901	regulation of cell migration
GO:0031399	0.889	regulation of protein modification process
GO:0042325	0.879	regulation of phosphorylation
GO:0045765	0.876	regulation of angiogenesis
GO:0008284	0.874	positive regulation of cell population proliferation
GO:0051896	0.857	regulation of protein kinase B signaling
GO:0045766	0.856	positive regulation of angiogenesis
GO:0050679	0.846	positive regulation of epithelial cell proliferation
GO:0001936	0.845	regulation of endothelial cell proliferation
GO:0030335	0.837	positive regulation of cell migration
GO:0050920	0.832	regulation of chemotaxis
GO:0048523	0.830	negative regulation of cellular process
GO:0009893	0.826	positive regulation of metabolic process
GO:0051897	0.826	positive regulation of protein kinase B signaling
GO:0031325	0.821	positive regulation of cellular metabolic process
GO:0010604	0.820	positive regulation of macromolecule metabolic process
GO:0001932	0.799	regulation of protein phosphorylation
GO:0070372	0.779	regulation of ERK1 and ERK2 cascade
GO:0048731	0.773	system development
GO:0051716	0.772	cellular response to stimulus
GO:0051173	0.770	positive regulation of nitrogen compound metabolic process
GO:0070374	0.754	positive regulation of ERK1 and ERK2 cascade
GO:0001934	0.752	positive regulation of protein phosphorylation
GO:0001938	0.750	positive regulation of endothelial cell proliferation
GO:0007154	0.746	cell communication
GO:0023052	0.740	signaling
GO:0090287	0.730	regulation of cellular response to growth factor stimulus
GO:0050921	0.725	positive regulation of chemotaxis
GO:0007165	0.704	signal transduction
GO:0080134	0.677	regulation of response to stress
GO:0010941	0.670	regulation of cell death
GO:0008152	0.668	metabolic process
GO:0043066	0.634	negative regulation of apoptotic process
GO:0071704	0.621	organic substance metabolic process
GO:0002682	0.601	regulation of immune system process
GO:0002685	0.583	regulation of leukocyte migration
GO:0044238	0.577	primary metabolic process
GO:0007166	0.561	cell surface receptor signaling pathway
GO:0050730	0.548	regulation of peptidyl-tyrosine phosphorylation
GO:0065009	0.547	regulation of molecular function
GO:0002688	0.546	regulation of leukocyte chemotaxis
GO:0006807	0.516	nitrogen compound metabolic process
GO:0050731	0.513	positive regulation of peptidyl-tyrosine phosphorylation
GO:0072359	0.501	circulatory system development
GO:0043170	0.499	macromolecule metabolic process
GO:0042221	0.497	response to chemical
GO:0050790	0.493	regulation of catalytic activity
GO:0044237	0.491	cellular metabolic process
GO:0002684	0.489	positive regulation of immune system process
GO:0010468	0.458	regulation of gene expression
GO:0030947	0.456	regulation of vascular endothelial growth factor receptor signaling pathway
GO:0001944	0.443	vasculature development
GO:1901564	0.428	organonitrogen compound metabolic process
GO:0050926	0.426	regulation of positive chemotaxis
GO:0044093	0.417	positive regulation of molecular function
GO:0019538	0.413	protein metabolic process
GO:1903034	0.408	regulation of response to wounding
GO:0051338	0.401	regulation of transferase activity
GO:0043085	0.387	positive regulation of catalytic activity
GO:0001568	0.386	blood vessel development
GO:0033674	0.377	positive regulation of kinase activity
GO:0002687	0.376	positive regulation of leukocyte migration
GO:0009653	0.372	anatomical structure morphogenesis
GO:0007169	0.365	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048869	0.306	cellular developmental process
GO:0010605	0.303	negative regulation of macromolecule metabolic process
GO:0030154	0.301	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0012505	0.995	endomembrane system
GO:0070013	0.993	intracellular organelle lumen
GO:0043227	0.968	membrane-bounded organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0005615	0.927	extracellular space
GO:0031410	0.880	cytoplasmic vesicle
GO:0071944	0.868	cell periphery
GO:0016020	0.721	membrane
GO:0099503	0.703	secretory vesicle
GO:0030141	0.679	secretory granule
GO:0031093	0.659	platelet alpha granule lumen
GO:0005886	0.452	plasma membrane
GO:0031981	0.366	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]