StarFunc result for job id P49767

User Input

>input (419 residues)
MHLLGFFSVACSLLAAALLPGPREAPAAAAAFESGLDLSDAEPDAGEATAYASKDLEEQL
RSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILK
SIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSY
LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAAN
KTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
PASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCAC
ECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49767	1.000	1.000	8.067E-83	419	1.000	1.000	P49767.pdb.gz	VEGFC_HUMAN Vascular endothelial growth factor C OS=Homo sapiens OX=9606 GN=VEGFC PE=1 SV=1
2	AFDB:O35757	0.667	0.673	8.424E-69	415	0.847	0.855	O35757.pdb.gz	VEGFC_RAT Vascular endothelial growth factor C OS=Rattus norvegicus OX=10116 GN=Vegfc PE=1 SV=2
3	AFDB:Q7T3I6	0.536	0.559	4.990E-51	396	0.558	0.591	Q7T3I6.pdb.gz	Q7T3I6_DANRE Vascular endothelial growth factor C OS=Danio rerio OX=7955 GN=vegfc PE=2 SV=1
4	AFDB:P97946	0.345	0.400	1.794E-30	358	0.315	0.369	P97946.pdb.gz	VEGFD_MOUSE Vascular endothelial growth factor D OS=Mus musculus OX=10090 GN=Vegfd PE=2 SV=1
5	AFDB:O43915	0.389	0.455	2.529E-29	354	0.305	0.362	O43915.pdb.gz	VEGFD_HUMAN Vascular endothelial growth factor D OS=Homo sapiens OX=9606 GN=VEGFD PE=1 SV=1
6	AFDB:Q208T6	0.370	0.550	6.492E-23	272	0.217	0.335	Q208T6.pdb.gz	Q208T6_DANRE C-fos induced growth factor OS=Danio rerio OX=7955 GN=figf PE=2 SV=1
7	AFDB:E7EZR4	0.218	0.364	4.442E-14	246	0.134	0.228	E7EZR4.pdb.gz	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
8	AFDB:Q1ECU5	0.215	0.351	1.357E-13	250	0.138	0.232	Q1ECU5.pdb.gz
9	AFDB:Q5RHW5	0.215	0.388	1.717E-13	228	0.126	0.232	Q5RHW5.pdb.gz
10	AFDB:P15692	0.206	0.366	7.469E-13	232	0.131	0.237	P15692.pdb.gz	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
11	PDB:1wq8A	0.200	0.788	3.259E-8	100	0.060	0.250	1wq8A.pdb.gz
12	PDB:1m4uA	0.153	0.288	3.138E-4	199	0.072	0.151	1m4uA.pdb.gz
13	PDB:5vqfB	0.138	0.172	4.170E-3	320	0.050	0.066	5vqfB.pdb.gz
14	PDB:1hcnB	0.147	0.487	7.963E-3	110	0.038	0.145	1hcnB.pdb.gz
15	PDB:4my2A	0.157	0.140	9.499E-3	474	0.050	0.044	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
16	PDB:7ag0A	0.140	0.350	1.520E-2	140	0.045	0.136	7ag0A.pdb.gz
17	PDB:5ffoG	0.136	0.180	1.710E-2	297	0.043	0.061	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:2k8pA	0.139	0.276	2.581E-2	189	0.072	0.159	2k8pA.pdb.gz
19	PDB:3rjrC	0.129	0.152	2.737E-2	343	0.045	0.055	3rjrC.pdb.gz
20	PDB:5hk5F	0.143	0.385	3.673E-2	129	0.043	0.140	5hk5F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35757	0.0	730	415	0.847	0.855	VEGFC_RAT Vascular endothelial growth factor C OS=Rattus norvegicus OX=10116 GN=Vegfc PE=1 SV=2
2	P49767	0.0	872	419	1.000	1.000	VEGFC_HUMAN Vascular endothelial growth factor C OS=Homo sapiens OX=9606 GN=VEGFC PE=1 SV=1
3	P97953	0.0	738	415	0.854	0.863	VEGFC_MOUSE Vascular endothelial growth factor C OS=Mus musculus OX=10090 GN=Vegfc PE=1 SV=1
4	Q7T3I6	1.33e-157	452	396	0.568	0.601	Q7T3I6_DANRE Vascular endothelial growth factor C OS=Danio rerio OX=7955 GN=vegfc PE=2 SV=1
5	O43915	1.40e-74	238	354	0.325	0.384	VEGFD_HUMAN Vascular endothelial growth factor D OS=Homo sapiens OX=9606 GN=VEGFD PE=1 SV=1
6	O35251	7.31e-72	230	326	0.320	0.411	VEGFD_RAT Vascular endothelial growth factor D OS=Rattus norvegicus OX=10116 GN=Vegfd PE=1 SV=1
7	P97946	2.63e-71	230	358	0.322	0.377	VEGFD_MOUSE Vascular endothelial growth factor D OS=Mus musculus OX=10090 GN=Vegfd PE=2 SV=1
8	Q208T6	2.05e-48	168	272	0.227	0.349	Q208T6_DANRE C-fos induced growth factor OS=Danio rerio OX=7955 GN=figf PE=2 SV=1
9	Q9MYV3	6.14e-14	72.8	214	0.091	0.178	VEGFA_CANLF Vascular endothelial growth factor A OS=Canis lupus familiaris OX=9615 GN=VEGFA PE=1 SV=1
10	P15692	7.63e-14	72.8	232	0.091	0.164	VEGFA_HUMAN Vascular endothelial growth factor A, long form OS=Homo sapiens OX=9606 GN=VEGFA PE=1 SV=3
11	E7EZR4	9.90e-13	69.7	246	0.084	0.142	E7EZR4_DANRE Vascular endothelial growth factor A-like OS=Danio rerio OX=7955 GN=vegfba PE=3 SV=1
12	P15691	3.46e-12	67.0	190	0.112	0.247	VEGFA_BOVIN Vascular endothelial growth factor A OS=Bos taurus OX=9913 GN=VEGFA PE=1 SV=1
13	Q00731	7.53e-12	66.6	214	0.084	0.164	VEGFA_MOUSE Vascular endothelial growth factor A, long form OS=Mus musculus OX=10090 GN=Vegfa PE=1 SV=3
14	P16612	1.13e-11	66.2	214	0.084	0.164	VEGFA_RAT Vascular endothelial growth factor A OS=Rattus norvegicus OX=10116 GN=Vegfa PE=1 SV=2
15	Q0QYI0	2.12e-11	65.1	194	0.074	0.160	Q0QYI0_DANRE Vascular endothelial growth factor A isoform 2 precursor (Fragment) OS=Danio rerio OX=7955 GN=fd42e02 PE=2 SV=1
16	O73682	4.33e-11	63.9	188	0.072	0.160	VGFAA_DANRE Vascular endothelial growth factor A-A OS=Danio rerio OX=7955 GN=vegfaa PE=1 SV=1
17	P49766	2.92e-09	58.9	207	0.081	0.164	VEGFB_MOUSE Vascular endothelial growth factor B OS=Mus musculus OX=10090 GN=Vegfb PE=2 SV=2
18	P83942	3.71e-09	56.2	110	0.060	0.227	TXVE_VIPAP Snake venom vascular endothelial growth factor toxin HF OS=Vipera aspis aspis OX=194601 PE=1 SV=1
19	Q330K6	4.79e-09	57.0	143	0.067	0.196	TXVE2_PROMU Snake venom vascular endothelial growth factor toxin OS=Protobothrops mucrosquamatus OX=103944 PE=1 SV=1
20	O35485	8.40e-09	57.8	207	0.079	0.159	VEGFB_RAT Vascular endothelial growth factor B OS=Rattus norvegicus OX=10116 GN=Vegfb PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03128 CXCXC	3.7e-07	41.1	CXCXC repeat
2	PF00341 PDGF	1.5e-19	81.4	PDGF/VEGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261937	0.999	Vascular endothelial growth factor receptor 3
2	9606.ENSP00000263923	0.999	Vascular endothelial growth factor receptor 2
3	9606.ENSP00000353582	0.999	Neuropilin-2
4	9606.ENSP00000282397	0.987	Vascular endothelial growth factor receptor 1
5	9606.ENSP00000264741	0.965	Integrin alpha-9
6	9606.ENSP00000379350	0.936	Integrin beta-1
7	9606.ENSP00000401303	0.933	SHC-transforming protein 1
8	9606.ENSP00000263967	0.925	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
9	9606.ENSP00000376345	0.918	Growth factor receptor-bound protein 2
10	9606.ENSP00000431418	0.915	High affinity nerve growth factor receptor
11	9606.ENSP00000428056	0.913	Phosphatidylinositol 3-kinase regulatory subunit alpha
12	9606.ENSP00000297904	0.912	Vascular endothelial growth factor D
13	9606.ENSP00000410402	0.909	Dual specificity mitogen-activated protein kinase kinase 4
14	9606.ENSP00000256178	0.908	Lymphatic vessel endothelial hyaluronic acid receptor 1
15	9606.ENSP00000300574	0.905	Adapter molecule crk
16	9606.ENSP00000387784	0.905	Son of sevenless homolog 1
17	9606.ENSP00000456226	0.900	Interferon induced transmembrane protein domain containing
18	9606.ENSP00000404464	0.898	Collagen and calcium-binding EGF domain-containing protein 1
19	9606.ENSP00000369375	0.878	Angiopoietin-1 receptor
20	9606.ENSP00000341815	0.845	Transcription factor SOX-18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005172	1.000	vascular endothelial growth factor receptor binding
GO:0048018	1.000	receptor ligand activity
GO:0043185	0.949	vascular endothelial growth factor receptor 3 binding
GO:0042056	0.870	chemoattractant activity
GO:0008083	0.658	growth factor activity
GO:0042802	0.548	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.990	positive regulation of cellular process
GO:0032501	0.989	multicellular organismal process
GO:0048856	0.989	anatomical structure development
GO:0051716	0.985	cellular response to stimulus
GO:0051239	0.979	regulation of multicellular organismal process
GO:0007166	0.978	cell surface receptor signaling pathway
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0008284	0.977	positive regulation of cell population proliferation
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0007275	0.973	multicellular organism development
GO:0007169	0.957	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048731	0.949	system development
GO:0048010	0.949	vascular endothelial growth factor receptor signaling pathway
GO:0040012	0.943	regulation of locomotion
GO:0010646	0.942	regulation of cell communication
GO:0009653	0.940	anatomical structure morphogenesis
GO:0042221	0.938	response to chemical
GO:0050793	0.938	regulation of developmental process
GO:0023051	0.937	regulation of signaling
GO:0051246	0.934	regulation of protein metabolic process
GO:2000145	0.933	regulation of cell motility
GO:0051174	0.931	regulation of phosphorus metabolic process
GO:0045765	0.924	regulation of angiogenesis
GO:0048583	0.923	regulation of response to stimulus
GO:0030334	0.915	regulation of cell migration
GO:0051240	0.903	positive regulation of multicellular organismal process
GO:0019220	0.901	regulation of phosphate metabolic process
GO:0051094	0.895	positive regulation of developmental process
GO:0030335	0.889	positive regulation of cell migration
GO:1904018	0.878	positive regulation of vasculature development
GO:0001934	0.875	positive regulation of protein phosphorylation
GO:0050920	0.848	regulation of chemotaxis
GO:0048519	0.825	negative regulation of biological process
GO:0032103	0.811	positive regulation of response to external stimulus
GO:0045597	0.798	positive regulation of cell differentiation
GO:0050921	0.783	positive regulation of chemotaxis
GO:0002685	0.761	regulation of leukocyte migration
GO:0009966	0.743	regulation of signal transduction
GO:0070887	0.735	cellular response to chemical stimulus
GO:0048523	0.733	negative regulation of cellular process
GO:0030154	0.730	cell differentiation
GO:0016477	0.696	cell migration
GO:0065009	0.694	regulation of molecular function
GO:0050790	0.675	regulation of catalytic activity
GO:0007399	0.651	nervous system development
GO:0050769	0.640	positive regulation of neurogenesis
GO:0008283	0.636	cell population proliferation
GO:0035295	0.620	tube development
GO:0044093	0.570	positive regulation of molecular function
GO:0031952	0.517	regulation of protein autophosphorylation
GO:0051338	0.510	regulation of transferase activity
GO:0002684	0.496	positive regulation of immune system process
GO:0043549	0.476	regulation of kinase activity
GO:0050678	0.466	regulation of epithelial cell proliferation
GO:0006950	0.431	response to stress
GO:0009719	0.420	response to endogenous stimulus
GO:0045766	0.393	positive regulation of angiogenesis
GO:0023056	0.378	positive regulation of signaling
GO:0010647	0.378	positive regulation of cell communication
GO:1902531	0.378	regulation of intracellular signal transduction
GO:0050679	0.376	positive regulation of epithelial cell proliferation
GO:0010468	0.373	regulation of gene expression
GO:0009967	0.369	positive regulation of signal transduction
GO:0043085	0.368	positive regulation of catalytic activity
GO:0010033	0.324	response to organic substance
GO:1902533	0.318	positive regulation of intracellular signal transduction
GO:0002687	0.300	positive regulation of leukocyte migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0012505	0.994	endomembrane system
GO:0070013	0.994	intracellular organelle lumen
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005737	0.967	cytoplasm
GO:0005615	0.952	extracellular space
GO:0031410	0.929	cytoplasmic vesicle
GO:0016020	0.799	membrane
GO:0099503	0.761	secretory vesicle
GO:0071944	0.737	cell periphery
GO:0030141	0.733	secretory granule
GO:0060205	0.721	cytoplasmic vesicle lumen
GO:0034774	0.712	secretory granule lumen
GO:0031091	0.674	platelet alpha granule
GO:0031093	0.580	platelet alpha granule lumen
GO:0005886	0.465	plasma membrane
GO:0031981	0.370	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]