StarFunc result for job id P49768

User Input

>input (467 residues)
MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97887	0.818	0.816	2.254E-54	468	0.927	0.925	P97887.pdb.gz	PSN1_RAT Presenilin-1 OS=Rattus norvegicus OX=10116 GN=Psen1 PE=1 SV=1
2	AFDB:Q9W6T7	0.732	0.749	4.791E-43	456	0.702	0.719	Q9W6T7.pdb.gz	PSN1_DANRE Presenilin-1 OS=Danio rerio OX=7955 GN=psen1 PE=1 SV=1
3	AFDB:O88777	0.703	0.733	1.311E-39	448	0.621	0.647	O88777.pdb.gz	PSN2_RAT Presenilin-2 OS=Rattus norvegicus OX=10116 GN=Psen2 PE=1 SV=2
4	AFDB:Q90ZE4	0.698	0.738	3.689E-39	441	0.625	0.662	Q90ZE4.pdb.gz	PSN2_DANRE Presenilin-2 OS=Danio rerio OX=7955 GN=psen2 PE=2 SV=2
5	AFDB:B7Z090	0.703	0.647	1.795E-34	508	0.529	0.486	B7Z090.pdb.gz	B7Z090_DROME Presenilin OS=Drosophila melanogaster OX=7227 GN=Psn PE=1 SV=1
6	AFDB:M9PG70	0.704	0.609	8.980E-33	541	0.527	0.455	M9PG70.pdb.gz	M9PG70_DROME Presenilin OS=Drosophila melanogaster OX=7227 GN=Psn PE=1 SV=1
7	PDB:6idfB	0.653	0.972	9.361E-33	312	0.662	0.990	6idfB.pdb.gz	Structural basis of Notch recognition by human gamma-secretase
8	AFDB:P52166	0.686	0.720	2.480E-30	444	0.460	0.484	P52166.pdb.gz	PSN_CAEEL Presenilin sel-12 OS=Caenorhabditis elegans OX=6239 GN=sel-12 PE=1 SV=2
9	PDB:5fn3B	0.582	0.939	2.083E-26	286	0.600	0.979	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
10	AFDB:Q54DE8	0.608	0.600	5.133E-21	473	0.298	0.294	Q54DE8.pdb.gz	PSNB_DICDI Presenilin-B OS=Dictyostelium discoideum OX=44689 GN=psenB PE=3 SV=1
11	AFDB:Q38F54	0.646	0.819	2.710E-20	365	0.276	0.353	Q38F54.pdb.gz	Q38F54_TRYB2 Presenilin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3510 PE=3 SV=1
12	AFDB:Q54ET2	0.592	0.453	1.143E-19	622	0.315	0.236	Q54ET2.pdb.gz	PSNA_DICDI Presenilin-A OS=Dictyostelium discoideum OX=44689 GN=psenA PE=3 SV=1
13	PDB:7y5xB	0.443	0.973	1.059E-16	211	0.377	0.834	7y5xB.pdb.gz	Molecular basis for isoform-selective inhibition of presenilin-1 by MRK-560.
14	PDB:5fn5B	0.430	0.857	2.080E-16	223	0.473	0.991	5fn5B.pdb.gz
15	PDB:4hygB	0.382	0.669	4.968E-3	247	0.107	0.202	4hygB.pdb.gz
16	PDB:7t55A	0.128	0.096	1.643	715	0.116	0.076	7t55A.pdb.gz	Structures of the peptidase-containing ABC transporter PCAT1 under equilibrium and nonequilibrium conditions.
17	PDB:7w2zR	0.096	0.129	2.250	301	0.092	0.143	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
18	PDB:5nbdA	0.105	0.095	2.575	564	0.094	0.078	5nbdA.pdb.gz	Structural basis of inhibition of lipid-linked oligosaccharide flippase PglK by a conformational nanobody.
19	PDB:5u1dA	0.100	0.086	2.694	561	0.081	0.068	5u1dA.pdb.gz
20	PDB:6kkkA	0.114	0.130	3.083	381	0.113	0.139	6kkkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R6A3	0.0	966	467	1.000	1.000	A0A024R6A3_HUMAN Presenilin (Fragment) OS=Homo sapiens OX=9606 GN=PSEN1 PE=2 SV=1
2	A0A0S2Z4D2	0.0	952	463	0.991	1.000	A0A0S2Z4D2_HUMAN Presenilin (Fragment) OS=Homo sapiens OX=9606 GN=PSEN1 PE=2 SV=1
3	F7AGU8	0.0	952	463	0.991	1.000	F7AGU8_MACMU Presenilin OS=Macaca mulatta OX=9544 GN=PSEN1 PE=2 SV=3
4	G3V4M0	0.0	774	427	0.914	1.000	G3V4M0_HUMAN Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=2
5	O88777	0.0	527	448	0.636	0.663	PSN2_RAT Presenilin-2 OS=Rattus norvegicus OX=10116 GN=Psen2 PE=1 SV=2
6	P49768	0.0	966	467	1.000	1.000	PSN1_HUMAN Presenilin-1 OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=1
7	P49769	0.0	811	467	0.927	0.927	PSN1_MOUSE Presenilin-1 OS=Mus musculus OX=10090 GN=Psen1 PE=1 SV=1
8	P49810	0.0	544	448	0.647	0.674	PSN2_HUMAN Presenilin-2 OS=Homo sapiens OX=9606 GN=PSEN2 PE=1 SV=1
9	P97887	0.0	814	468	0.927	0.925	PSN1_RAT Presenilin-1 OS=Rattus norvegicus OX=10116 GN=Psen1 PE=1 SV=1
10	Q61144	0.0	534	448	0.634	0.661	PSN2_MOUSE Presenilin-2 OS=Mus musculus OX=10090 GN=Psen2 PE=1 SV=3
11	Q90ZE4	0.0	526	441	0.642	0.680	PSN2_DANRE Presenilin-2 OS=Danio rerio OX=7955 GN=psen2 PE=2 SV=2
12	Q9W6T7	0.0	554	456	0.713	0.730	PSN1_DANRE Presenilin-1 OS=Danio rerio OX=7955 GN=psen1 PE=1 SV=1
13	B7Z090	2.65e-144	424	508	0.505	0.465	B7Z090_DROME Presenilin OS=Drosophila melanogaster OX=7227 GN=Psn PE=1 SV=1
14	M9PFS2	1.27e-143	423	527	0.512	0.454	M9PFS2_DROME Presenilin OS=Drosophila melanogaster OX=7227 GN=Psn PE=1 SV=1
15	P52166	2.15e-142	417	444	0.473	0.498	PSN_CAEEL Presenilin sel-12 OS=Caenorhabditis elegans OX=6239 GN=sel-12 PE=1 SV=2
16	M9PG70	1.37e-141	418	541	0.516	0.445	M9PG70_DROME Presenilin OS=Drosophila melanogaster OX=7227 GN=Psn PE=1 SV=1
17	O02194	1.37e-141	418	541	0.516	0.445	PSN_DROME Presenilin homolog OS=Drosophila melanogaster OX=7227 GN=Psn PE=1 SV=2
18	G3V2G7	2.48e-110	324	155	0.332	1.000	G3V2G7_HUMAN Presenilin 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=1
19	G3V3Z0	6.00e-94	281	135	0.289	1.000	G3V3Z0_HUMAN Presenilin 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=1
20	G3V4P4	3.50e-75	233	109	0.233	1.000	G3V4P4_HUMAN Presenilin-1 (Fragment) OS=Homo sapiens OX=9606 GN=PSEN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01080 Presenilin	1.8e-155	529.5	Presenilin
2	PF01988 VIT1	36	15.7	VIT family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003543

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011964	0.999	Aph-1 homolog A, gamma-secretase subunit
2	61853.ENSNLEP00000013808	0.999	Presenilin enhancer gamma-secretase subunit
3	61853.ENSNLEP00000016503	0.999	Nicastrin
4	61853.ENSNLEP00000006991	0.998	Catenin beta 1
5	61853.ENSNLEP00000014874	0.996	Aph-1 homolog B, gamma-secretase subunit
6	61853.ENSNLEP00000003308	0.992	Amyloid beta (A4) precursor protein
7	61853.ENSNLEP00000006160	0.983	Glycogen synthase kinase 3 beta
8	61853.ENSNLEP00000019964	0.975	Transmembrane emp24-like trafficking protein 10 (yeast)
9	61853.ENSNLEP00000021805	0.946	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
10	61853.ENSNLEP00000004432	0.940	Inositol 1,4,5-trisphosphate receptor, type 1
11	61853.ENSNLEP00000010158	0.936	Notch 1
12	61853.ENSNLEP00000016908	0.936	Presenilin
13	61853.ENSNLEP00000006645	0.929	Notch 2
14	61853.ENSNLEP00000006507	0.918	Cadherin 1
15	61853.ENSNLEP00000010258	0.894	Inositol 1,4,5-trisphosphate receptor, type 3
16	61853.ENSNLEP00000008103	0.870	Notch 4
17	61853.ENSNLEP00000006493	0.859	Inositol 1,4,5-trisphosphate receptor, type 2
18	61853.ENSNLEP00000013043	0.845	Ryanodine receptor 3
19	61853.ENSNLEP00000018333	0.839	Endoplasmic reticulum to nucleus signaling 1
20	61853.ENSNLEP00000009112	0.837	Amyloid beta (A4) precursor-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.989	protein binding
GO:0004175	0.989	endopeptidase activity
GO:0070001	0.876	aspartic-type peptidase activity
GO:0004190	0.852	aspartic-type endopeptidase activity
GO:0015318	0.786	inorganic molecular entity transmembrane transporter activity
GO:0008324	0.785	monoatomic cation transmembrane transporter activity
GO:0022890	0.784	inorganic cation transmembrane transporter activity
GO:0046873	0.774	metal ion transmembrane transporter activity
GO:0042802	0.670	identical protein binding
GO:0042500	0.580	aspartic endopeptidase activity, intramembrane cleaving
GO:0019899	0.560	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.985	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0071704	0.966	organic substance metabolic process
GO:0048856	0.957	anatomical structure development
GO:0032501	0.946	multicellular organismal process
GO:0044238	0.945	primary metabolic process
GO:1901564	0.942	organonitrogen compound metabolic process
GO:0043170	0.938	macromolecule metabolic process
GO:0019538	0.934	protein metabolic process
GO:0050896	0.925	response to stimulus
GO:0007275	0.740	multicellular organism development
GO:0051716	0.693	cellular response to stimulus
GO:0048519	0.645	negative regulation of biological process
GO:0048518	0.628	positive regulation of biological process
GO:0019222	0.579	regulation of metabolic process
GO:0048731	0.558	system development
GO:0060255	0.539	regulation of macromolecule metabolic process
GO:0051171	0.527	regulation of nitrogen compound metabolic process
GO:0080090	0.525	regulation of primary metabolic process
GO:0048523	0.514	negative regulation of cellular process
GO:0048522	0.506	positive regulation of cellular process
GO:0007154	0.489	cell communication
GO:0023052	0.465	signaling
GO:0006508	0.461	proteolysis
GO:0007165	0.460	signal transduction
GO:0065009	0.451	regulation of molecular function
GO:0051179	0.407	localization
GO:0042981	0.406	regulation of apoptotic process
GO:0006950	0.377	response to stress
GO:0031323	0.374	regulation of cellular metabolic process
GO:0009893	0.365	positive regulation of metabolic process
GO:0010604	0.363	positive regulation of macromolecule metabolic process
GO:0051246	0.361	regulation of protein metabolic process
GO:0071840	0.356	cellular component organization or biogenesis
GO:0016043	0.354	cellular component organization
GO:0010468	0.354	regulation of gene expression
GO:0048583	0.342	regulation of response to stimulus
GO:0023051	0.332	regulation of signaling
GO:0010467	0.329	gene expression
GO:0010646	0.328	regulation of cell communication
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0042221	0.322	response to chemical
GO:0050790	0.317	regulation of catalytic activity
GO:0048869	0.315	cellular developmental process
GO:0007399	0.311	nervous system development
GO:0030154	0.303	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0030054	0.997	cell junction
GO:0005654	0.996	nucleoplasm
GO:0016020	0.987	membrane
GO:0005794	0.967	Golgi apparatus
GO:0071944	0.956	cell periphery
GO:0005886	0.937	plasma membrane
GO:0032991	0.846	protein-containing complex
GO:0031982	0.817	vesicle
GO:0097708	0.705	intracellular vesicle
GO:0031410	0.690	cytoplasmic vesicle
GO:0005783	0.394	endoplasmic reticulum
GO:0031090	0.364	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.989	Acting on peptide bonds (peptidases).
EC:3.4.23.-	0.852	Aspartic endopeptidases.

[back to server]