StarFunc result for job id P49770

User Input

>input (351 residues)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49770	1.000	1.000	1.718E-60	351	1.000	1.000	P49770.pdb.gz	EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3
2	PDB:7f66C	0.920	0.964	8.578E-50	335	0.946	0.991	7f66C.pdb.gz
3	PDB:6ezoD	0.850	0.966	1.940E-39	308	0.875	0.997	6ezoD.pdb.gz	Binding of ISRIB reveals a regulatory site in the nucleotide exchange factor eIF2B.
4	AFDB:O76863	0.905	0.903	5.522E-36	352	0.464	0.463	O76863.pdb.gz	O76863_DROME EG:100G10.3 protein OS=Drosophila melanogaster OX=7227 GN=eIF2Bbeta PE=1 SV=1
5	PDB:5b04C	0.876	0.881	1.463E-33	349	0.405	0.407	5b04C.pdb.gz
6	AFDB:Q9UT76	0.873	0.781	5.419E-33	393	0.407	0.364	Q9UT76.pdb.gz	EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif222 PE=1 SV=1
7	AFDB:B3H7H1	0.871	0.751	8.832E-33	409	0.419	0.359	B3H7H1.pdb.gz	B3H7H1_ARATH AT3G07300 protein OS=Arabidopsis thaliana OX=3702 GN=At3g07300 PE=1 SV=1
8	AFDB:P32502	0.871	0.805	3.241E-29	381	0.333	0.307	P32502.pdb.gz	EI2BB_YEAST Translation initiation factor eIF-2B subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD7 PE=1 SV=1
9	AFDB:Q57VZ6	0.822	0.615	2.884E-26	475	0.336	0.248	Q57VZ6.pdb.gz	Q57VZ6_TRYB2 Translation initiation factor eIF-2B beta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.770 PE=3 SV=1
10	PDB:6i3mE	0.863	0.856	1.076E-23	354	0.328	0.325	6i3mE.pdb.gz	The structural basis of translational control by eIF2 phosphorylation.
11	AFDB:Q9VAD4	0.698	0.793	4.338E-21	306	0.205	0.235	Q9VAD4.pdb.gz	Q9VAD4_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=1 SV=1
12	AFDB:Q14232	0.693	0.790	9.954E-21	305	0.208	0.239	Q14232.pdb.gz	EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1
13	AFDB:A0A1P8AVS2	0.738	0.638	2.645E-20	409	0.185	0.159	A0A1P8AVS2.pdb.gz	A0A1P8AVS2_ARATH eIF-2B GDP-GTP exchange factor subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At1g72340 PE=1 SV=1
14	PDB:7l7gF	0.702	0.691	2.671E-20	357	0.208	0.204	7l7gF.pdb.gz	eIF2B conformation and assembly state regulates the integrated stress response.
15	AFDB:P34604	0.694	0.791	3.545E-20	305	0.179	0.207	P34604.pdb.gz	EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans OX=6239 GN=ZK1098.4 PE=1 SV=1
16	PDB:3ecsC	0.666	0.782	4.543E-19	294	0.219	0.262	3ecsC.pdb.gz	Crystal structure of the alpha subunit of human translation initiation factor 2B
17	PDB:7kmaB	0.645	0.831	2.770E-18	268	0.194	0.254	7kmaB.pdb.gz	Sugar phosphate activation of the stress sensor eIF2B.
18	PDB:5b04B	0.696	0.761	6.014E-17	319	0.225	0.248	5b04B.pdb.gz
19	PDB:6jlyG	0.683	0.663	8.890E-17	363	0.182	0.176	6jlyG.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
20	PDB:4ldqB	0.599	0.592	6.919E-16	356	0.182	0.180	4ldqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49770	0.0	723	351	1.000	1.000	EI2BB_HUMAN Translation initiation factor eIF-2B subunit beta OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=3
2	Q53XC2	0.0	723	351	1.000	1.000	Q53XC2_HUMAN Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=1
3	Q62818	0.0	679	351	0.929	0.929	EI2BB_RAT Translation initiation factor eIF-2B subunit beta OS=Rattus norvegicus OX=10116 GN=Eif2b2 PE=2 SV=1
4	Q9BPX4	0.0	722	351	0.997	0.997	Q9BPX4_HUMAN Eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa OS=Homo sapiens OX=9606 GN=EIF2B2 PE=1 SV=1
5	O76863	1.35e-107	320	352	0.462	0.460	O76863_DROME EG:100G10.3 protein OS=Drosophila melanogaster OX=7227 GN=eIF2Bbeta PE=1 SV=1
6	Q9UT76	9.92e-75	238	393	0.305	0.272	EI2BB_SCHPO Probable translation initiation factor eIF-2B subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif222 PE=1 SV=1
7	B3H7H1	1.00e-61	204	409	0.311	0.267	B3H7H1_ARATH AT3G07300 protein OS=Arabidopsis thaliana OX=3702 GN=At3g07300 PE=1 SV=1
8	P32502	2.53e-50	174	381	0.336	0.310	EI2BB_YEAST Translation initiation factor eIF-2B subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD7 PE=1 SV=1
9	Q57VZ6	2.23e-37	142	475	0.234	0.173	Q57VZ6_TRYB2 Translation initiation factor eIF-2B beta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.770 PE=3 SV=1
10	Q64270	2.97e-22	97.4	305	0.199	0.230	EI2BA_RAT Translation initiation factor eIF-2B subunit alpha OS=Rattus norvegicus OX=10116 GN=Eif2b1 PE=2 SV=1
11	Q99LC8	3.81e-22	97.1	305	0.205	0.236	EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus OX=10090 GN=Eif2b1 PE=1 SV=1
12	Q14232	4.71e-21	94.0	305	0.199	0.230	EI2BA_HUMAN Translation initiation factor eIF-2B subunit alpha OS=Homo sapiens OX=9606 GN=EIF2B1 PE=1 SV=1
13	Q9VAD4	6.57e-21	93.6	306	0.185	0.212	Q9VAD4_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=1 SV=1
14	Q9GQ89	7.61e-21	93.2	300	0.185	0.217	Q9GQ89_DROME eIF-2B GDP-GTP exchange factor subunit alpha OS=Drosophila melanogaster OX=7227 GN=eIF2Balpha PE=2 SV=1
15	P14741	4.62e-19	88.6	305	0.162	0.187	EI2BA_YEAST Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN3 PE=1 SV=1
16	Q63186	1.99e-18	88.6	524	0.174	0.116	EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus OX=10116 GN=Eif2b4 PE=2 SV=1
17	Q9UI10	2.90e-18	87.8	523	0.188	0.126	EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens OX=9606 GN=EIF2B4 PE=1 SV=2
18	A0A1P8AVS2	1.73e-16	82.0	409	0.168	0.144	A0A1P8AVS2_ARATH eIF-2B GDP-GTP exchange factor subunit alpha OS=Arabidopsis thaliana OX=3702 GN=At1g72340 PE=1 SV=1
19	P34604	3.38e-15	77.4	305	0.151	0.174	EI2BA_CAEEL Probable translation initiation factor eIF-2B subunit alpha OS=Caenorhabditis elegans OX=6239 GN=ZK1098.4 PE=1 SV=1
20	Q09924	4.33e-13	72.4	467	0.145	0.109	EI2BD_SCHPO Probable translation initiation factor eIF-2B subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif224 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13264 DUF4055	1.4e+02	14.0	Domain of unknown function (DUF4055)
2	PF01008 IF-2B	2.8e-88	307.4	Initiation factor 2 subunit family
3	PF09402 MSC	1.1e+02	13.7	Man1-Src1p-C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253039	0.999	Eukaryotic translation initiation factor 2 subunit 3
2	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
3	9606.ENSP00000273783	0.999	Translation initiation factor eIF-2B subunit epsilon
4	9606.ENSP00000353575	0.999	Translation initiation factor eIF-2B subunit gamma
5	9606.ENSP00000394869	0.999	Translation initiation factor eIF-2B subunit delta
6	9606.ENSP00000416250	0.999	Translation initiation factor eIF-2B subunit alpha
7	9606.ENSP00000364119	0.996	Eukaryotic translation initiation factor 2 subunit 2
8	9606.ENSP00000445077	0.903	Putative eukaryotic translation initiation factor 2 subunit 3-like protein
9	9606.ENSP00000263791	0.864	eIF-2-alpha kinase GCN2
10	9606.ENSP00000216554	0.813	Eukaryotic translation initiation factor 5
11	9606.ENSP00000433664	0.802	Eukaryotic translation initiation factor 4 gamma 2
12	9606.ENSP00000278715	0.697	Porphobilinogen deaminase
13	9606.ENSP00000355512	0.674	Opsin-3
14	9606.ENSP00000423399	0.669	Mitochondrial ribosomal protein L36
15	9606.ENSP00000431800	0.663	Eukaryotic translation initiation factor 3 subunit F
16	9606.ENSP00000199389	0.660	Eukaryotic translation initiation factor 2-alpha kinase 1
17	9606.ENSP00000482753	0.655	Guanine nucleotide exchange C9orf72
18	9606.ENSP00000264932	0.653	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
19	9606.ENSP00000309092	0.650	Mannose-1-phosphate guanyltransferase beta
20	9606.ENSP00000376587	0.649	Acetyl-coenzyme A transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0005085	0.995	guanyl-nucleotide exchange factor activity
GO:0003743	0.990	translation initiation factor activity
GO:0005525	0.610	GTP binding
GO:0005524	0.604	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0009628	0.946	response to abiotic stimulus
GO:0071704	0.944	organic substance metabolic process
GO:0044237	0.907	cellular metabolic process
GO:0006807	0.897	nitrogen compound metabolic process
GO:0044238	0.895	primary metabolic process
GO:0032502	0.861	developmental process
GO:1901564	0.860	organonitrogen compound metabolic process
GO:0043170	0.859	macromolecule metabolic process
GO:0034641	0.819	cellular nitrogen compound metabolic process
GO:1901566	0.819	organonitrogen compound biosynthetic process
GO:0044271	0.804	cellular nitrogen compound biosynthetic process
GO:0019538	0.803	protein metabolic process
GO:0010467	0.802	gene expression
GO:0044260	0.800	cellular macromolecule metabolic process
GO:0032501	0.792	multicellular organismal process
GO:0006412	0.782	translation
GO:0048856	0.773	anatomical structure development
GO:0048518	0.773	positive regulation of biological process
GO:0007275	0.750	multicellular organism development
GO:0007399	0.698	nervous system development
GO:0006950	0.598	response to stress
GO:0019222	0.519	regulation of metabolic process
GO:0051716	0.488	cellular response to stimulus
GO:0060255	0.470	regulation of macromolecule metabolic process
GO:0051171	0.449	regulation of nitrogen compound metabolic process
GO:0031323	0.444	regulation of cellular metabolic process
GO:0080090	0.439	regulation of primary metabolic process
GO:0051246	0.419	regulation of protein metabolic process
GO:0006413	0.399	translational initiation
GO:0009889	0.379	regulation of biosynthetic process
GO:0010468	0.378	regulation of gene expression
GO:0010556	0.370	regulation of macromolecule biosynthetic process
GO:0031326	0.369	regulation of cellular biosynthetic process
GO:0009266	0.342	response to temperature stimulus
GO:0006417	0.314	regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005851	0.999	eukaryotic translation initiation factor 2B complex
GO:0005829	0.992	cytosol
GO:0043227	0.967	membrane-bounded organelle
GO:0043229	0.955	intracellular organelle
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0012505	0.907	endomembrane system
GO:0016020	0.800	membrane
GO:0030054	0.401	cell junction
GO:0005783	0.325	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]