StarFunc result for job id P49771

User Input

>input (235 residues)
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTV
ASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCL
RFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT
APQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49771	1.000	1.000	3.481E-41	235	1.000	1.000	P49771.pdb.gz	FLT3L_HUMAN Fms-related tyrosine kinase 3 ligand OS=Homo sapiens OX=9606 GN=FLT3LG PE=1 SV=1
2	AFDB:P49772	0.612	0.620	8.433E-28	232	0.685	0.694	P49772.pdb.gz	FLT3L_MOUSE Fms-related tyrosine kinase 3 ligand OS=Mus musculus OX=10090 GN=Flt3lg PE=2 SV=1
3	AFDB:D8UWE0	0.371	0.332	2.136E-4	270	0.149	0.130	D8UWE0.pdb.gz	D8UWE0_CHICK Colony-stimulating factor 1 OS=Gallus gallus OX=9031 GN=CSF1 PE=2 SV=1
4	AFDB:F1RDP0	0.362	0.327	2.544E-4	267	0.200	0.176	F1RDP0.pdb.gz
5	AFDB:P07141	0.403	0.190	1.955E-3	552	0.157	0.067	P07141.pdb.gz	CSF1_MOUSE Macrophage colony-stimulating factor 1 OS=Mus musculus OX=10090 GN=Csf1 PE=1 SV=2
6	AFDB:A0A0B5JQ49	0.405	0.218	7.464E-3	482	0.140	0.068	A0A0B5JQ49.pdb.gz
7	PDB:2gmfA	0.253	0.397	1.266E-1	121	0.060	0.116	2gmfA.pdb.gz
8	PDB:6ke6RC	0.142	0.121	2.547E-1	278	0.136	0.115	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
9	PDB:4nemA	0.296	0.532	4.561E-1	114	0.051	0.105	4nemA.pdb.gz	Small molecular fragments bound to binding energy hot-spot in crystal contact interface of Interleukin-2
10	PDB:2oqpA	0.249	0.380	5.758E-1	134	0.068	0.119	2oqpA.pdb.gz
11	PDB:1cnt2	0.238	0.369	8.657E-1	130	0.085	0.154	1cnt2.pdb.gz
12	PDB:1ga3A	0.225	0.353	9.726E-1	113	0.094	0.195	1ga3A.pdb.gz
13	PDB:7mq8NY	0.139	0.125	1.158	274	0.123	0.106	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5xjt2	0.114	0.120	1.228	217	0.098	0.106	5xjt2.pdb.gz	Structures of 7S mutant complexes
15	PDB:7ra9A	0.281	0.448	1.302	126	0.060	0.111	7ra9A.pdb.gz
16	PDB:3di3A	0.265	0.478	1.742	118	0.102	0.203	3di3A.pdb.gz
17	AFDB:G3V8Y7	0.144	0.072	1.891	569	0.187	0.077	G3V8Y7.pdb.gz	AP4AT_RAT AP-4 complex accessory subunit Tepsin OS=Rattus norvegicus OX=10116 GN=Tepsin PE=1 SV=1
18	AFDB:G5EF53	0.120	0.039	2.387	1474	0.136	0.022	G5EF53.pdb.gz	SWSN4_CAEEL SWI/SNF chromatin remodeling complex core catalytic subunit swsn-4 OS=Caenorhabditis elegans OX=6239 GN=swsn-4 PE=1 SV=1
19	AFDB:O74653	0.106	0.047	2.387	871	0.157	0.042	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
20	AFDB:Q9VGX0	0.153	0.143	2.387	261	0.081	0.073	Q9VGX0.pdb.gz	Q9VGX0_DROME Desiccate OS=Drosophila melanogaster OX=7227 GN=Desi PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49771	4.55e-169	467	235	1.000	1.000	FLT3L_HUMAN Fms-related tyrosine kinase 3 ligand OS=Homo sapiens OX=9606 GN=FLT3LG PE=1 SV=1
2	A0A1W2Q6J3	2.82e-86	257	230	0.685	0.700	A0A1W2Q6J3_RAT Ribosomal protein L13A OS=Rattus norvegicus OX=10116 GN=Flt3lg PE=4 SV=2
3	A0A1W2Q6L2	1.34e-84	260	444	0.677	0.358	A0A1W2Q6L2_RAT Large ribosomal subunit protein uL13 OS=Rattus norvegicus OX=10116 GN=Flt3lg PE=1 SV=2
4	P49772	1.50e-84	253	232	0.694	0.703	FLT3L_MOUSE Fms-related tyrosine kinase 3 ligand OS=Mus musculus OX=10090 GN=Flt3lg PE=2 SV=1
5	A0A0G2K6K8	1.51e-76	234	274	0.672	0.577	A0A0G2K6K8_RAT Ribosomal protein L13A OS=Rattus norvegicus OX=10116 GN=Flt3lg PE=4 SV=2
6	A0A1W2Q636	1.22e-67	207	171	0.489	0.673	A0A1W2Q636_RAT Ribosomal protein L13A OS=Rattus norvegicus OX=10116 GN=Flt3lg PE=4 SV=1
7	A0A0S2Z417	0.76	33.1	497	0.081	0.038	A0A0S2Z417_HUMAN Myocyte enhancer factor 2A isoform 4 (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
8	Q60929	0.76	33.1	498	0.081	0.038	MEF2A_MOUSE Myocyte-specific enhancer factor 2A OS=Mus musculus OX=10090 GN=Mef2a PE=1 SV=2
9	A0A0S2Z4N0	0.79	33.1	505	0.081	0.038	A0A0S2Z4N0_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
10	Q550K3	1.0	33.1	1462	0.077	0.012	Q550K3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277075 PE=4 SV=1
11	A0A8I5Y766	1.5	32.3	747	0.085	0.027	A0A8I5Y766_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
12	A0A8I6A4L8	1.5	32.3	744	0.085	0.027	A0A8I6A4L8_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
13	A0A8I5Y6V6	1.7	32.3	786	0.085	0.025	A0A8I5Y6V6_RAT ADAM metallopeptidase domain 28 OS=Rattus norvegicus OX=10116 GN=Adam28 PE=4 SV=1
14	Q6EIY6	1.7	32.3	614	0.085	0.033	Q6EIY6_DANRE Myeloproliferative leukemia virus oncogene, like OS=Danio rerio OX=7955 GN=mpll PE=2 SV=1
15	A0A0S2Z4C8	3.1	31.2	429	0.068	0.037	A0A0S2Z4C8_HUMAN Myocyte enhancer factor 2A isoform 5 (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
16	A0A0R4ICG0	4.0	31.2	1387	0.072	0.012	A0A0R4ICG0_DANRE Period 1 isoform X1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=1
17	P22329	4.1	30.8	362	0.098	0.064	OPSR_CHICK Red-sensitive opsin OS=Gallus gallus OX=9031 PE=1 SV=1
18	Q7SZZ4	4.4	31.2	1229	0.072	0.014	Q7SZZ4_DANRE Period 1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=3
19	Q8BHM9	6.0	30.4	439	0.064	0.034	TM11F_MOUSE Transmembrane protease serine 11F OS=Mus musculus OX=10090 GN=Tmprss11f PE=2 SV=1
20	Q8K4C2	8.1	30.0	698	0.085	0.029	I17RC_MOUSE Interleukin-17 receptor C OS=Mus musculus OX=10090 GN=Il17rc PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19706 DUF6203	5.1	18.4	Family of unknown function (DUF6203)
2	PF02947 Flt3_lig	3.6e-67	236.0	flt3 ligand

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469613

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241453	0.999	Receptor-type tyrosine-protein kinase FLT3
2	9606.ENSP00000228280	0.912	Kit ligand
3	9606.ENSP00000358548	0.910	GTPase NRas
4	9606.ENSP00000407586	0.908	GTPase HRas
5	9606.ENSP00000256078	0.904	GTPase KRas
6	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000441543	0.902	Polyubiquitin-C
8	9606.ENSP00000228872	0.901	Cyclin-dependent kinase inhibitor 1B
9	9606.ENSP00000272317	0.900	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000304697	0.900	Polyubiquitin-B
11	9606.ENSP00000400010	0.900	Receptor-type tyrosine-protein phosphatase eta
12	9606.ENSP00000286301	0.850	Macrophage colony-stimulating factor 1 receptor
13	9606.ENSP00000288135	0.848	Mast/stem cell growth factor receptor Kit
14	9606.ENSP00000431418	0.791	High affinity nerve growth factor receptor
15	9606.ENSP00000296870	0.783	Interleukin-3
16	9606.ENSP00000296871	0.772	Granulocyte-macrophage colony-stimulating factor
17	9606.ENSP00000204615	0.765	Thrombopoietin
18	9606.ENSP00000337825	0.759	Tyrosine-protein kinase Lck
19	9606.ENSP00000225474	0.757	Granulocyte colony-stimulating factor
20	9606.ENSP00000310036	0.736	Hematopoietic progenitor cell antigen CD34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0048522	0.983	positive regulation of cellular process
GO:0042127	0.946	regulation of cell population proliferation
GO:0008284	0.943	positive regulation of cell population proliferation
GO:0050896	0.932	response to stimulus
GO:0048856	0.929	anatomical structure development
GO:0032501	0.921	multicellular organismal process
GO:0051716	0.884	cellular response to stimulus
GO:0023052	0.883	signaling
GO:0007154	0.881	cell communication
GO:0007165	0.874	signal transduction
GO:0030154	0.785	cell differentiation
GO:0051239	0.725	regulation of multicellular organismal process
GO:0051240	0.626	positive regulation of multicellular organismal process
GO:0002682	0.617	regulation of immune system process
GO:0002684	0.544	positive regulation of immune system process
GO:0030097	0.528	hemopoiesis
GO:0019222	0.513	regulation of metabolic process
GO:0007275	0.512	multicellular organism development
GO:0060255	0.431	regulation of macromolecule metabolic process
GO:0050865	0.401	regulation of cell activation
GO:0009893	0.396	positive regulation of metabolic process
GO:0031323	0.379	regulation of cellular metabolic process
GO:0051249	0.366	regulation of lymphocyte activation
GO:0051251	0.361	positive regulation of lymphocyte activation
GO:0070663	0.356	regulation of leukocyte proliferation
GO:0080090	0.337	regulation of primary metabolic process
GO:0010604	0.337	positive regulation of macromolecule metabolic process
GO:0070665	0.336	positive regulation of leukocyte proliferation
GO:0051171	0.330	regulation of nitrogen compound metabolic process
GO:0048519	0.320	negative regulation of biological process
GO:0010468	0.311	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005829	0.997	cytosol
GO:0016020	0.953	membrane
GO:0005886	0.926	plasma membrane
GO:0043231	0.745	intracellular membrane-bounded organelle
GO:0005615	0.680	extracellular space
GO:0009986	0.490	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]