StarFunc result for job id P49789

User Input

>input (147 residues)
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQ
TTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKH
DKEDFPASWRSEEEMAAEAAALRVYFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O89106	0.988	0.969	1.724E-26	150	0.905	0.887	O89106.pdb.gz	FHIT_MOUSE Bis(5'-adenosyl)-triphosphatase OS=Mus musculus OX=10090 GN=Fhit PE=1 SV=3
2	PDB:7p8pB	0.977	0.977	2.323E-26	147	0.980	0.980	7p8pB.pdb.gz	Chemical Proteomics of the Tumor Suppressor Fhit Covalently Bound to the Cofactor Ap 3 A Elucidates Its Inhibitory Action on Translation.
3	PDB:2fitA	0.859	0.970	2.270E-22	130	0.884	1.000	2fitA.pdb.gz	MAD analysis of FHIT, a putative human tumor suppressor from the HIT protein family.
4	AFDB:F4KEV7	0.928	0.762	6.421E-17	180	0.510	0.417	F4KEV7.pdb.gz	FHIT_ARATH Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT OS=Arabidopsis thaliana OX=3702 GN=FHIT PE=1 SV=1
5	AFDB:O76463	0.932	0.317	1.892E-16	440	0.469	0.157	O76463.pdb.gz	NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans OX=6239 GN=nft-1 PE=1 SV=1
6	AFDB:P49776	0.898	0.727	4.563E-15	182	0.456	0.368	P49776.pdb.gz	APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aph1 PE=1 SV=2
7	AFDB:O76464	0.921	0.301	8.833E-15	460	0.381	0.122	O76464.pdb.gz	NFT1_DROME Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster OX=7227 GN=NitFhit PE=1 SV=1
8	PDB:1emsA	0.821	0.296	8.632E-14	412	0.415	0.148	1emsA.pdb.gz
9	AFDB:P49775	0.830	0.600	3.882E-13	206	0.367	0.262	P49775.pdb.gz	HNT2_YEAST Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HNT2 PE=1 SV=2
10	AFDB:Q72BI4	0.671	0.572	2.984E-9	174	0.190	0.161	Q72BI4.pdb.gz	Q72BI4_DESVH HIT family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1652 PE=1 SV=1
11	PDB:3anoA	0.616	0.578	6.499E-9	158	0.245	0.228	3anoA.pdb.gz	Structural insights into the novel diadenosine 5',5-P1,P4-tetraphosphate phosphorylase from Mycobacterium tuberculosis H37Rv
12	PDB:3anoB	0.654	0.556	7.329E-9	175	0.245	0.206	3anoB.pdb.gz	Structural insights into the novel diadenosine 5',5-P1,P4-tetraphosphate phosphorylase from Mycobacterium tuberculosis H37Rv
13	AFDB:P9WMK9	0.656	0.505	1.118E-8	195	0.238	0.179	P9WMK9.pdb.gz	AP4A_MYCTU AP-4-A phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2613c PE=1 SV=1
14	AFDB:F4K1R2	0.689	0.523	1.339E-8	197	0.170	0.127	F4K1R2.pdb.gz	HINT3_ARATH Adenylylsulfatase HINT3 OS=Arabidopsis thaliana OX=3702 GN=HINT3 PE=1 SV=1
15	AFDB:O94586	0.571	0.629	2.121E-7	133	0.177	0.195	O94586.pdb.gz	HNT1_SCHPO Adenosine 5'-monophosphoramidase hnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hnt1 PE=3 SV=1
16	PDB:6ypxAAA	0.512	0.644	1.071E-6	113	0.150	0.195	6ypxAAA.pdb.gz
17	PDB:3n1sJ	0.548	0.661	2.201E-6	119	0.129	0.160	3n1sJ.pdb.gz	Probing the Impact of the echinT C-Terminal Domain on Structure and Catalysis.
18	PDB:6g9zA	0.517	0.612	3.778E-6	121	0.150	0.182	6g9zA.pdb.gz
19	PDB:6gqdA	0.535	0.253	6.353E-5	344	0.238	0.102	6gqdA.pdb.gz	Structure of human galactose-1-phosphate uridylyltransferase (GALT), with crystallization epitope mutations A21Y:A22T:T23P:R25L
20	PDB:6id0U	0.540	0.252	4.087E-4	347	0.150	0.063	6id0U.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49789	2.94e-107	303	147	1.000	1.000	FHIT_HUMAN Bis(5'-adenosyl)-triphosphatase OS=Homo sapiens OX=9606 GN=FHIT PE=1 SV=3
2	O89106	1.95e-87	253	150	0.912	0.893	FHIT_MOUSE Bis(5'-adenosyl)-triphosphatase OS=Mus musculus OX=10090 GN=Fhit PE=1 SV=3
3	Q9JIX3	2.65e-87	253	150	0.884	0.867	FHIT_RAT Bis(5'-adenosyl)-triphosphatase OS=Rattus norvegicus OX=10116 GN=Fhit PE=1 SV=1
4	F4KEV7	3.83e-47	152	180	0.517	0.422	FHIT_ARATH Bifunctional bis(5'-adenosyl)-triphosphatase/adenylylsulfatase FHIT OS=Arabidopsis thaliana OX=3702 GN=FHIT PE=1 SV=1
5	P49776	6.35e-36	124	182	0.388	0.313	APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aph1 PE=1 SV=2
6	O76463	3.43e-33	122	440	0.469	0.157	NFT1_CAEEL Nitrilase and fragile histidine triad fusion protein NitFhit OS=Caenorhabditis elegans OX=6239 GN=nft-1 PE=1 SV=1
7	O76464	2.02e-26	104	460	0.388	0.124	NFT1_DROME Nitrilase and fragile histidine triad fusion protein NitFhit OS=Drosophila melanogaster OX=7227 GN=NitFhit PE=1 SV=1
8	P49775	8.13e-24	93.6	206	0.320	0.228	HNT2_YEAST Bis(5'-adenosyl)-triphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HNT2 PE=1 SV=2
9	P9WMK9	1.99e-10	58.2	195	0.218	0.164	AP4A_MYCTU AP-4-A phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2613c PE=1 SV=1
10	Q72BI4	8.77e-08	50.8	174	0.163	0.138	Q72BI4_DESVH HIT family protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1652 PE=1 SV=1
11	F4K1R2	9.60e-07	48.1	197	0.184	0.137	HINT3_ARATH Adenylylsulfatase HINT3 OS=Arabidopsis thaliana OX=3702 GN=HINT3 PE=1 SV=1
12	O94586	3.71e-06	45.8	133	0.184	0.203	HNT1_SCHPO Adenosine 5'-monophosphoramidase hnt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hnt1 PE=3 SV=1
13	Q9I882	9.00e-06	44.7	126	0.218	0.254	Q9I882_CHICK Protein kinase C inhibitor OS=Gallus gallus OX=9031 GN=chPKCI PE=2 SV=1
14	Q04344	1.28e-05	44.7	158	0.184	0.171	HNT1_YEAST Adenosine 5'-monophosphoramidase HNT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HNT1 PE=1 SV=2
15	D4A269	0.054	34.3	126	0.184	0.214	D4A269_RAT Histidine triad nucleotide binding protein 1, pseudogene 1 OS=Rattus norvegicus OX=10116 GN=Hint1 PE=1 SV=1
16	Q9D0S9	0.094	33.9	163	0.136	0.123	HINT2_MOUSE Adenosine 5'-monophosphoramidase HINT2 OS=Mus musculus OX=10090 GN=Hint2 PE=1 SV=1
17	Q8GYJ9	0.099	33.9	187	0.204	0.160	Q8GYJ9_ARATH HISTIDINE TRIAD NUCLEOTIDE-BINDING 2 OS=Arabidopsis thaliana OX=3702 GN=HINT PE=1 SV=1
18	A0A384NPU2	0.10	33.5	126	0.184	0.214	A0A384NPU2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HINT1 PE=2 SV=1
19	P49773	0.10	33.5	126	0.184	0.214	HINT1_HUMAN Adenosine 5'-monophosphoramidase HINT1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2
20	F1RKI3	0.17	32.7	126	0.184	0.214	F1RKI3_PIG Histidine triad nucleotide binding protein 1 OS=Sus scrofa OX=9823 GN=HINT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11969 DcpS_C	0.0029	29.5	Scavenger mRNA decapping enzyme C-term binding
2	PF01230 HIT	2e-23	94.2	HIT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416515	0.986	NADPH:adrenodoxin oxidoreductase, mitochondrial
2	9606.ENSP00000457230	0.860	WW domain-containing oxidoreductase
3	9606.ENSP00000382595	0.810	Multifunctional protein ADE2
4	9606.ENSP00000318066	0.803	Bis(5'-adenosyl)-triphosphatase ENPP4
5	9606.ENSP00000344456	0.793	Catenin beta-1
6	9606.ENSP00000306817	0.791	Ribokinase
7	9606.ENSP00000373073	0.785	Urocanate hydratase 1
8	9606.ENSP00000397261	0.785	Selenium-binding protein 1
9	9606.ENSP00000263579	0.771	m7GpppX diphosphatase
10	9606.ENSP00000269305	0.747	Cellular tumor antigen p53
11	9606.ENSP00000349547	0.739	Ras association domain-containing protein 1
12	9606.ENSP00000264954	0.726	GrpE protein homolog 1, mitochondrial
13	9606.ENSP00000329558	0.726	GrpE protein homolog 2, mitochondrial
14	9606.ENSP00000452552	0.725	Zinc finger protein 37 homolog
15	9606.ENSP00000233893	0.719	10 kDa heat shock protein, mitochondrial
16	9606.ENSP00000348056	0.718	SUMO-conjugating enzyme UBC9
17	9606.ENSP00000400806	0.716	Aprataxin
18	9606.ENSP00000418915	0.716	Cyclin-dependent kinase inhibitor 2A
19	9606.ENSP00000280551	0.704	Protein transport protein Sec24D
20	9606.ENSP00000343405	0.704	Protein transport protein Sec24C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	0.999	pyrophosphatase activity
GO:0019899	0.996	enzyme binding
GO:0016811	0.996	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0070566	0.995	adenylyltransferase activity
GO:0031625	0.977	ubiquitin protein ligase binding
GO:0042802	0.950	identical protein binding
GO:0043530	0.900	adenosine 5'-monophosphoramidase activity
GO:0047627	0.834	adenylylsulfatase activity
GO:0047710	0.783	bis(5'-adenosyl)-triphosphatase activity
GO:0047352	0.545	adenylylsulfate-ammonia adenylyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:1901360	0.978	organic cyclic compound metabolic process
GO:0046483	0.965	heterocycle metabolic process
GO:0006725	0.959	cellular aromatic compound metabolic process
GO:0034641	0.947	cellular nitrogen compound metabolic process
GO:0006139	0.941	nucleobase-containing compound metabolic process
GO:0065007	0.882	biological regulation
GO:0050789	0.864	regulation of biological process
GO:0009056	0.863	catabolic process
GO:0006793	0.826	phosphorus metabolic process
GO:0050794	0.825	regulation of cellular process
GO:0050896	0.824	response to stimulus
GO:1901575	0.824	organic substance catabolic process
GO:0006796	0.746	phosphate-containing compound metabolic process
GO:0046434	0.707	organophosphate catabolic process
GO:0044248	0.653	cellular catabolic process
GO:0019439	0.629	aromatic compound catabolic process
GO:1901361	0.628	organic cyclic compound catabolic process
GO:0044281	0.600	small molecule metabolic process
GO:0051716	0.565	cellular response to stimulus
GO:0019222	0.530	regulation of metabolic process
GO:0060255	0.503	regulation of macromolecule metabolic process
GO:0055086	0.502	nucleobase-containing small molecule metabolic process
GO:0048519	0.496	negative regulation of biological process
GO:0034655	0.493	nucleobase-containing compound catabolic process
GO:0051171	0.434	regulation of nitrogen compound metabolic process
GO:0006753	0.429	nucleoside phosphate metabolic process
GO:0080090	0.423	regulation of primary metabolic process
GO:0043170	0.421	macromolecule metabolic process
GO:0009117	0.407	nucleotide metabolic process
GO:0048523	0.372	negative regulation of cellular process
GO:0031323	0.370	regulation of cellular metabolic process
GO:0009166	0.346	nucleotide catabolic process
GO:0007154	0.330	cell communication
GO:0051246	0.321	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.998	membrane
GO:0071944	0.997	cell periphery
GO:0031981	0.996	nuclear lumen
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005886	0.984	plasma membrane
GO:0005829	0.945	cytosol
GO:0005730	0.903	nucleolus
GO:0001650	0.865	fibrillar center
GO:0005654	0.597	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.999	In phosphorus-containing anhydrides.
EC:3.5.1.-	0.996	In linear amides.
EC:2.7.7.-	0.995	Nucleotidyltransferases.
RHEA:67916	0.900	adenosine 5'-phosphoramidate + H2O = AMP + NH4(+)
RHEA:17041	0.834	adenosine 5'-phosphosulfate + H2O = AMP + 2 H(+) + sulfate
EC:3.6.2.1	0.834	adenylylsulfatase.
RHEA:13893	0.783	H2O + P(1),P(3)-bis(5'-adenosyl) triphosphate = ADP + AMP + 2 H(+)
EC:3.6.1.29	0.783	bis(5'-adenosyl)-triphosphatase.
RHEA:19197	0.545	adenosine 5'-phosphosulfate + NH4(+) = adenosine 5'-phosphoramidate + 2 H(+) + sulfate
EC:2.7.7.51	0.545	adenylylsulfate--ammonia adenylyltransferase.

[back to server]