StarFunc result for job id P49790

User Input

>input (1475 residues)
MASGAGGVGGGGGGKIRTRRCHQGPIKPYQQGRQQHQGILSRVTESVKNIVPGWLQRYFN
KNEDVCSCSTDTSEVPRWPENKEDHLVYADEESSNITDGRITPEPAVSNTEEPSTTSTAS
NYPDVLTRPSLHRSHLNFSMLESPALHCQPSTSSAFPIGSSGFSLVKEIKDSTSQHDDDN
ISTTSGFSSRASDKDITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLS
PSLGNSSILKTSQLGDSPFYPGKTTYGGAAAAVRQSKLRNTPYQAPVRRQMKAKQLSAQS
YGVTSSTARRILQSLEKMSSPLADAKRIPSIVSSPLNSPLDRSGIDITDFQAKREKVDSQ
YPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQ
RESGFSYPNFSLPAANGLSSGVGGGGGKMRRERTRFVASKPLEEEEMEVPVLPKISLPIT
SSSLPTFNFSSPEITTSSPSPINSSQALTNKVQMTSPSSTGSPMFKFSSPIVKSTEANVL
PPSSIGFTFSVPVAKTAELSGSSSTLEPIISSSAHHVTTVNSTNCKKTPPEDCEGPFRPA
EILKEGSVLDILKSPGFASPKIDSVAAQPTATSPVVYTRPAISSFSSSGIGFGESLKAGS
SWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFK
PVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVT
TGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSG
GSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPGTKSGFKGFDTSSSSSNSAAS
SSFKFGVSSSSSGPSQTLTSTGNFKFGDQGGFKIGVSSDSGSINPMSEGFKFSKPIGDFK
FGVSSESKPEEVKKDSKNDNFKFGLSSGLSNPVSLTPFQFGVSNLGQEEKKEELPKSSSA
GFSFGTGVINSTPAPANTIVTSENKSSFNLGTIETKSASVAPFTCKTSEAKKEEMPATKG
GFSFGNVEPASLPSASVFVLGRTEEKQQEPVTSTSLVFGKKADNEEPKCQPVFSFGNSEQ
TKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQTSTTADQGAAKPVFSFLNNSSSSS
STPATSAGGGIFGSSTSSSNPPVATFVFGQSSNPVSSSAFGNTAESSTSQSLLFSQDSKL
ATTSSTGTAVTPFVFGPGASSNNTTTSGFGFGATTTSSSAGSSFVFGTGPSAPSASPAFG
ANQTPTFGQSQGASQPNPPGFGSISSSTALFPTGSQPAPPTFGTVSSSSQPPVFGQQPSQ
SAFGSGTTPNSSSAFQFGSSTTNFNFTNNSPSGVFTFGANSSTPAASAQPSGSGGFPFNQ
SPAAFTVGSNGKNVFSSSGTSFSGRKIKTAVRRRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49790	1.000	1.000	0.000	1475	1.000	1.000	P49790.pdb.gz	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
2	AFDB:P49791	0.146	0.147	0.000	1468	0.819	0.823	P49791.pdb.gz	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
3	AFDB:Q640Z6	0.093	0.088	2.655E-76	1605	0.479	0.440	Q640Z6.pdb.gz	NU153_XENLA Nuclear pore complex protein Nup153 OS=Xenopus laevis OX=8355 GN=nup153 PE=1 SV=1
4	AFDB:A0A0R4IVZ0	0.099	0.101	1.021E-68	1436	0.430	0.442	A0A0R4IVZ0.pdb.gz	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
5	AFDB:Q9VXE6	0.085	0.070	2.549E-21	1883	0.243	0.191	Q9VXE6.pdb.gz	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
6	AFDB:P91457	0.037	0.041	1.141E-11	1217	0.192	0.233	P91457.pdb.gz	P91457_CAEEL RanBP2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-7 PE=1 SV=1
7	AFDB:P35658	0.031	0.026	4.282E-7	2090	0.200	0.141	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
8	AFDB:Q9VPQ6	0.039	0.045	1.109E-6	1191	0.106	0.131	Q9VPQ6.pdb.gz	USH_DROME Zinc finger protein ush OS=Drosophila melanogaster OX=7227 GN=ush PE=1 SV=2
9	AFDB:Q96HA1	0.034	0.036	1.196E-5	1249	0.162	0.191	Q96HA1.pdb.gz	P121A_HUMAN Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121 PE=1 SV=2
10	AFDB:P52591	0.038	0.043	1.370E-5	1199	0.175	0.215	P52591.pdb.gz	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
11	PDB:7r7jB	0.016	0.041	1.674	574	0.005	0.012	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
12	PDB:4c2mI	0.021	0.191	2.196	124	0.016	0.194	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
13	PDB:5n5yI	0.021	0.199	2.196	99	0.012	0.172	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
14	PDB:7bhpLm	0.013	0.335	3.085	52	0.003	0.096	7bhpLm.pdb.gz	Dynamic association of human Ebp1 with the ribosome.
15	PDB:7d58L	0.024	0.503	3.534	47	0.005	0.149	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
16	PDB:3j79f	0.017	0.363	4.049	51	0.005	0.137	3j79f.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:6hlqI	0.021	0.217	4.964	111	0.012	0.153	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
18	PDB:7uhyD	0.018	0.078	4.964	288	0.005	0.024	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7oqyY	0.019	0.239	5.687	92	0.013	0.207	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
20	PDB:6hivA5	0.016	0.270	6.973	55	0.006	0.164	6hivA5.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVZ0	0.0	759	1436	0.441	0.453	A0A0R4IVZ0_DANRE Nuclear pore complex protein Nup153 OS=Danio rerio OX=7955 GN=fd23d09 PE=1 SV=1
2	P49790	0.0	2932	1475	1.000	1.000	NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2
3	P49791	0.0	2053	1468	0.807	0.811	NU153_RAT Nuclear pore complex protein Nup153 OS=Rattus norvegicus OX=10116 GN=Nup153 PE=1 SV=1
4	Q640Z6	0.0	937	1605	0.466	0.429	NU153_XENLA Nuclear pore complex protein Nup153 OS=Xenopus laevis OX=8355 GN=nup153 PE=1 SV=1
5	Q9VXE6	2.13e-37	156	1883	0.133	0.104	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
6	P49792	2.85e-36	153	3224	0.091	0.042	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
7	M0R3M4	1.60e-31	137	3089	0.091	0.043	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
8	A0A8I5YC36	1.76e-31	137	3114	0.091	0.043	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
9	Q9ERU9	3.67e-31	136	3053	0.083	0.040	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
10	D4A054	4.54e-31	136	3061	0.087	0.042	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
11	A0A0B4K7J2	2.06e-11	71.6	2718	0.035	0.019	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
12	P14907	6.13e-06	53.5	823	0.064	0.114	NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSP1 PE=1 SV=1
13	Q9UGI0	2.13e-05	51.6	708	0.036	0.075	ZRAN1_HUMAN Ubiquitin thioesterase ZRANB1 OS=Homo sapiens OX=9606 GN=ZRANB1 PE=1 SV=2
14	Q21021	1.23e-04	49.3	860	0.014	0.023	Q21021_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=2
15	Q86G90	1.32e-04	49.3	884	0.014	0.023	Q86G90_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-9 PE=1 SV=1
16	Q383G9	6.33e-04	47.0	1464	0.047	0.047	Q383G9_TRYB2 Spt5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2885 PE=4 SV=1
17	A0JMQ9	0.002	45.1	716	0.028	0.059	ZRN1B_DANRE Ubiquitin thioesterase zranb1-B OS=Danio rerio OX=7955 GN=zranb1b PE=2 SV=1
18	O75808	0.004	44.3	1086	0.018	0.025	CAN15_HUMAN Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1
19	P20676	0.009	43.1	1076	0.057	0.078	NUP1_YEAST Nucleoporin NUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP1 PE=1 SV=1
20	F4I6V3	0.020	41.6	466	0.026	0.084	F4I6V3_ARATH Ran BP2/NZF zinc finger-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g70650 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09339 HTH_IclR	8e+02	11.3	IclR helix-turn-helix domain
2	PF08604 Nup153	1.8e-254	856.9	Nucleoporin Nup153-like
3	PF10599 Nup_retrotrp_bd	1.2e-18	78.8	Retro-transposon transporting motif
4	PF00641 zf-RanBP	2.6e-40	146.7	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290158	0.999	Importin subunit beta-1
2	9606.ENSP00000345895	0.999	Nuclear pore complex protein Nup50
3	9606.ENSP00000356448	0.999	Nucleoprotein TPR
4	9606.ENSP00000316032	0.998	Nuclear pore complex protein Nup98-Nup96
5	9606.ENSP00000376077	0.998	Small ubiquitin-related modifier 1
6	9606.ENSP00000229179	0.997	Nuclear pore complex protein Nup107
7	9606.ENSP00000438483	0.997	Importin subunit alpha-1
8	9606.ENSP00000471191	0.997	Nuclear pore glycoprotein p62
9	9606.ENSP00000310668	0.996	Nuclear pore complex protein Nup93
10	9606.ENSP00000446215	0.996	GTP-binding nuclear protein Ran
11	9606.ENSP00000231498	0.995	Nuclear pore complex protein Nup155
12	9606.ENSP00000352400	0.994	Nuclear pore complex protein Nup214
13	9606.ENSP00000308622	0.993	Nucleoporin GLE1
14	9606.ENSP00000254508	0.991	Nuclear pore membrane glycoprotein 210
15	9606.ENSP00000261396	0.991	Nuclear pore complex protein Nup133
16	9606.ENSP00000245544	0.990	Nuclear pore complex protein Nup85
17	9606.ENSP00000219169	0.989	Nuclear transport factor 2
18	9606.ENSP00000264883	0.989	Nucleoporin p54
19	9606.ENSP00000436679	0.989	Nuclear RNA export factor 1
20	9606.ENSP00000384863	0.987	Exportin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0017056	0.976	structural constituent of nuclear pore
GO:0060090	0.975	molecular adaptor activity
GO:0043495	0.965	protein-membrane adaptor activity
GO:0042802	0.962	identical protein binding
GO:0097159	0.682	organic cyclic compound binding
GO:1901363	0.677	heterocyclic compound binding
GO:0003676	0.661	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0022607	0.941	cellular component assembly
GO:0048519	0.937	negative regulation of biological process
GO:0048523	0.927	negative regulation of cellular process
GO:0043933	0.925	protein-containing complex organization
GO:0006996	0.860	organelle organization
GO:0065003	0.860	protein-containing complex assembly
GO:0006997	0.815	nucleus organization
GO:0006999	0.752	nuclear pore organization
GO:0046931	0.743	pore complex assembly
GO:0032386	0.710	regulation of intracellular transport
GO:0046822	0.677	regulation of nucleocytoplasmic transport
GO:0032387	0.646	negative regulation of intracellular transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042405	1.000	nuclear inclusion body
GO:0034399	1.000	nuclear periphery
GO:0031965	1.000	nuclear membrane
GO:0044615	1.000	nuclear pore nuclear basket
GO:0005654	0.998	nucleoplasm
GO:0005829	0.995	cytosol
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005730	0.676	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]