StarFunc result for job id P49792

User Input

>input (1400 residues)
MRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQERDP
KAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWLER
AAKLFPGSPAIYKLKEQLLDCEGEDGWNKLFDLIQSELYVRPDDVHVNIRLVEVYRSTKR
LKDAVAHCHEAERNIALRSSLEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYA
NLMLLTLSTRDVQESRELLQSFDSALQSVKSLGGNDELSATFLEMKGHFYMHAGSLLLKM
GQHSSNVQWRALSELAALCYLIAFQVPRPKIKLIKGEAGQNLLEMMACDRLSQSGHMLLN
LSRGKQDFLKEIVETFANKSGQSALYDALFSSQSPKDTSFLGSDDIGNIDVREPELEDLT
RYDVGAIRAHNGSLQHLTWLGLQWNSLPALPGIRKWLKQLFHHLPHETSRLETNAPESIC
ILDLEVFLLGVVYTSHLQLKEKCNSHHSSYQPLCLPLPVCKQLCTERQKSWWDAVCTLIH
RKAVPGNVAKLRLLVQHEINTLRAQEKHGLQPALLVHWAECLQKTGSGLNSFYDQREYIG
RSVHYWKKVLPLLKIIKKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDAHITFAILDAV
NGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALSPEEQEECKNYLRKTRDYLIK
IIDDSDSNLSVVKKLPVPLESVKEMLNSVMQELEDYSEGGPLYKNGSLRNADSEIKHSTP
SPTRYSLSPSKSYKYSPKTPPRWAEDQNSLLKMICQQVEAIKKEMQELKLNSSNSASPHR
WPTENYGPDSVPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
PVYGMNRLPPQQHIYAYPQQMHTPPVQSSSACMFSQEMYGPPALRFESPATGILSPRGDD
YFNYNVQQTSTNPPLPEPGYFTKPPIAAHASRSAESKTIEFGKTNFVQPMPGEGLRPSLP
TQAHTTQPTPFKFNSNFKSNDGDFTFSSPQVVTQPPPAAYSNSESLLGLLTSDKPLQGDG
YSGAKPIPGGQTIGPRNTFNFGSKNVSGISFTENMGSSQQKNSGFRRSDDMFTFHGPGKS
VFGTPTLETANKNHETDGGSAHGDDDDDGPHFEPVVPLPDKIEVKTGEEDEEEFFCNRAK
LFRFDVESKEWKERGIGNVKILRHKTSGKIRLLMRREQVLKICANHYISPDMKLTPNAGS
DRSFVWHALDYADELPKPEQLAIRFKTPEEAALFKCKFEEAQSILKAPGTNVAMASNQAV
RIVKEPTSHDNKDICKSDAGNLNFEFQVAKKEGSWWHCNSCSLKNASTAKKCVSCQNLNP
SNKELVGPPLAETVFTPKTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5j00	0.514	0.930	3.382E-83	756	0.540	1.000	7r5j00.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	PDB:1k5dB	0.094	0.852	8.095E-12	146	0.062	0.596	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
3	PDB:3m1iB	0.090	0.926	2.881E-10	131	0.049	0.519	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
4	AFDB:E1C2U2	0.097	0.069	8.111E-9	2326	0.154	0.093	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
5	AFDB:Q6PR54	0.082	0.060	8.731E-9	2419	0.141	0.081	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
6	PDB:7dkhI	0.097	0.138	1.918E-8	914	0.069	0.105	7dkhI.pdb.gz
7	PDB:4bujB	0.115	0.117	3.587E-8	1367	0.074	0.075	4bujB.pdb.gz
8	AFDB:F4IAT2	0.073	0.064	1.382E-7	1823	0.134	0.103	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
9	AFDB:Q8IZD9	0.105	0.083	3.108E-7	2030	0.116	0.080	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
10	AFDB:P59764	0.100	0.078	4.172E-7	1978	0.119	0.084	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
11	AFDB:F4J8G7	0.105	0.083	1.048E-6	2138	0.140	0.092	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
12	PDB:6tedQ	0.099	0.140	1.186E-6	890	0.071	0.112	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:7qdrB	0.128	0.146	1.986E-6	1212	0.084	0.097	7qdrB.pdb.gz
14	AFDB:Q9VUH6	0.052	0.043	4.246E-6	1833	0.134	0.102	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
15	PDB:6yj6A	0.109	0.173	6.947E-6	819	0.064	0.110	6yj6A.pdb.gz
16	AFDB:Q2QCI8	0.073	0.062	1.191E-5	2173	0.102	0.066	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
17	PDB:7ntfA	0.110	0.155	2.021E-5	918	0.043	0.065	7ntfA.pdb.gz
18	AFDB:O95996	0.082	0.061	4.164E-5	2303	0.124	0.076	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
19	AFDB:A0A096MKF8	0.079	0.060	4.825E-5	2190	0.116	0.074	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
20	PDB:6c95A	0.137	0.232	5.668E-5	773	0.056	0.101	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC36	0.0	2607	3114	0.888	0.399	A0A8I5YC36_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=1
2	D4A054	0.0	2580	3061	0.883	0.404	D4A054_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=3
3	M0R3M4	0.0	2583	3089	0.883	0.400	M0R3M4_RAT RAN binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ranbp2 PE=1 SV=2
4	P49792	0.0	2943	3224	1.000	0.434	RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2
5	Q9ERU9	0.0	2601	3053	0.887	0.407	RBP2_MOUSE E3 SUMO-protein ligase RanBP2 OS=Mus musculus OX=10090 GN=Ranbp2 PE=1 SV=2
6	A0A8I5ZTU5	5.61e-52	184	219	0.071	0.457	A0A8I5ZTU5_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=1
7	P34022	2.00e-50	179	203	0.069	0.473	RANG_MOUSE Ran-specific GTPase-activating protein OS=Mus musculus OX=10090 GN=Ranbp1 PE=1 SV=2
8	F6WQW2	5.06e-50	181	278	0.069	0.345	F6WQW2_HUMAN RAN binding protein 1 OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
9	A0A140VK94	1.20e-49	177	201	0.069	0.483	A0A140VK94_HUMAN RAN binding protein 1, isoform CRA_g OS=Homo sapiens OX=9606 GN=RANBP1 PE=2 SV=1
10	P43487	1.20e-49	177	201	0.069	0.483	RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
11	D4A2G9	3.21e-49	175	188	0.068	0.505	D4A2G9_RAT RAN binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ranbp1 PE=1 SV=2
12	C9JJ34	1.45e-45	164	163	0.061	0.521	C9JJ34_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1
13	A0A1D8PRQ3	3.24e-41	153	212	0.054	0.358	A0A1D8PRQ3_CANAL Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YRB1 PE=4 SV=1
14	P41920	8.37e-38	143	201	0.061	0.423	YRB1_YEAST Ran-specific GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRB1 PE=1 SV=1
15	Q09717	1.16e-37	143	215	0.060	0.391	RANG_SCHPO Ran-specific GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sbp1 PE=1 SV=1
16	C9JXG8	4.07e-37	139	145	0.053	0.510	C9JXG8_HUMAN RAN binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=2
17	Q9LMK7	2.79e-34	134	228	0.046	0.281	RBP1A_ARATH Ran-binding protein 1 homolog a OS=Arabidopsis thaliana OX=3702 GN=RANBP1A PE=1 SV=1
18	Q8RWG8	3.04e-34	133	217	0.049	0.313	RBP1B_ARATH Ran-binding protein 1 homolog b OS=Arabidopsis thaliana OX=3702 GN=RANBP1B PE=1 SV=2
19	P92985	2.97e-33	130	219	0.047	0.301	RBP1C_ARATH Ran-binding protein 1 homolog c OS=Arabidopsis thaliana OX=3702 GN=RANBP1C PE=2 SV=1
20	Q54KD9	3.02e-32	127	194	0.048	0.345	RANG_DICDI Ran-specific GTPase-activating protein homolog OS=Dictyostelium discoideum OX=44689 GN=ranbp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00638 Ran_BP1	4.2e-53	190.2	RanBP1 domain
2	PF08238 Sel1	4.7e+02	12.9	Sel1 repeat
3	PF00515 TPR_1	0.00077	30.4	Tetratricopeptide repeat
4	PF13414 TPR_11	47	15.1	TPR repeat
5	PF13424 TPR_12	41	15.9	Tetratricopeptide repeat
6	PF13428 TPR_14	0.016	27.0	Tetratricopeptide repeat
7	PF13432 TPR_16	3	19.8	Tetratricopeptide repeat
8	PF13431 TPR_17	5e+02	12.5	Tetratricopeptide repeat
9	PF14559 TPR_19	0.73	21.7	Tetratricopeptide repeat
10	PF07719 TPR_2	0.00086	30.3	Tetratricopeptide repeat
11	PF13174 TPR_6	13	17.8	Tetratricopeptide repeat
12	PF13176 TPR_7	66	14.9	Tetratricopeptide repeat
13	PF13181 TPR_8	0.018	26.2	Tetratricopeptide repeat
14	PF00641 zf-RanBP	0.00019	32.0	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283195

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348056	0.999	SUMO-conjugating enzyme UBC9
2	9606.ENSP00000352400	0.999	Nuclear pore complex protein Nup214
3	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
4	9606.ENSP00000384863	0.999	Exportin-1
5	9606.ENSP00000401470	0.999	Ran GTPase-activating protein 1
6	9606.ENSP00000446215	0.999	GTP-binding nuclear protein Ran
7	9606.ENSP00000290158	0.996	Importin subunit beta-1
8	9606.ENSP00000405965	0.996	Small ubiquitin-related modifier 2
9	9606.ENSP00000349351	0.994	Protein bicaudal D homolog 2
10	9606.ENSP00000471191	0.994	Nuclear pore glycoprotein p62
11	9606.ENSP00000307078	0.993	Kinesin-1 heavy chain
12	9606.ENSP00000316032	0.989	Nuclear pore complex protein Nup98-Nup96
13	9606.ENSP00000356448	0.985	Nucleoprotein TPR
14	9606.ENSP00000444029	0.985	Nuclear pore complex protein Nup153
15	9606.ENSP00000458954	0.984	Nuclear pore complex protein Nup88
16	9606.ENSP00000219169	0.979	Nuclear transport factor 2
17	9606.ENSP00000254508	0.977	Nuclear pore membrane glycoprotein 210
18	9606.ENSP00000451291	0.977	Heterogeneous nuclear ribonucleoproteins C1/C2
19	9606.ENSP00000343023	0.972	Nuclear autoantigen Sp-100
20	9606.ENSP00000310668	0.971	Nuclear pore complex protein Nup93

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.999	protein-containing complex binding
GO:0019789	0.999	SUMO transferase activity
GO:0051020	0.986	GTPase binding
GO:0031267	0.983	small GTPase binding
GO:0061665	0.979	SUMO ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.882	response to stimulus
GO:1901698	0.855	response to nitrogen compound
GO:0009987	0.801	cellular process
GO:0014075	0.724	response to amine
GO:0001975	0.611	response to amphetamine
GO:0065007	0.302	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.997	cytoplasm
GO:0005635	0.997	nuclear envelope
GO:0005643	0.949	nuclear pore
GO:0016020	0.525	membrane
GO:0044614	0.440	nuclear pore cytoplasmic filaments
GO:0043233	0.418	organelle lumen
GO:0042175	0.404	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0070013	0.396	intracellular organelle lumen
GO:0031090	0.370	organelle membrane
GO:0005642	0.370	annulate lamellae
GO:1902494	0.364	catalytic complex
GO:0031965	0.363	nuclear membrane
GO:0106068	0.351	SUMO ligase complex
GO:0005654	0.336	nucleoplasm
GO:0044615	0.332	nuclear pore nuclear basket
GO:0042405	0.329	nuclear inclusion body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]