StarFunc result for job id P49795

User Input

>input (217 residues)
MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQ
ASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDA
QLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49795	0.999	0.999	3.752E-32	217	1.000	1.000	P49795.pdb.gz	RGS19_HUMAN Regulator of G-protein signaling 19 OS=Homo sapiens OX=9606 GN=RGS19 PE=1 SV=1
2	AFDB:Q8T017	0.644	0.512	1.178E-18	274	0.516	0.409	Q8T017.pdb.gz	Q8T017_DROME Double hit, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhit PE=1 SV=1
3	AFDB:B1H233	0.674	0.606	2.371E-18	242	0.562	0.504	B1H233.pdb.gz	B1H233_RAT Rgs20 protein OS=Rattus norvegicus OX=10116 GN=Rgs20 PE=2 SV=1
4	AFDB:O76081	0.668	0.383	2.895E-18	388	0.576	0.322	O76081.pdb.gz	RGS20_HUMAN Regulator of G-protein signaling 20 OS=Homo sapiens OX=9606 GN=RGS20 PE=1 SV=4
5	AFDB:F1M0G0	0.653	0.673	1.426E-16	210	0.493	0.510	F1M0G0.pdb.gz	F1M0G0_RAT Regulator of G-protein signaling 17 OS=Rattus norvegicus OX=10116 GN=Rgs17 PE=4 SV=2
6	AFDB:G5EFV0	0.632	0.753	3.005E-15	181	0.419	0.503	G5EFV0.pdb.gz	G5EFV0_CAEEL RGS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rgs-2 PE=4 SV=1
7	AFDB:D1MN65	0.625	0.552	6.997E-14	247	0.392	0.344	D1MN65.pdb.gz	D1MN65_CAEEL RGS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rgs-1 PE=4 SV=1
8	AFDB:Q99PG4	0.598	0.553	3.825E-13	235	0.318	0.294	Q99PG4.pdb.gz	RGS18_MOUSE Regulator of G-protein signaling 18 OS=Mus musculus OX=10090 GN=Rgs18 PE=1 SV=1
9	AFDB:Q6DC84	0.615	0.766	4.911E-13	173	0.323	0.405	Q6DC84.pdb.gz	Q6DC84_DANRE Regulator of G protein-signaling 3a OS=Danio rerio OX=7955 GN=zgc:100933 PE=2 SV=1
10	AFDB:Q08116	0.578	0.600	5.427E-13	209	0.313	0.325	Q08116.pdb.gz	RGS1_HUMAN Regulator of G-protein signaling 1 OS=Homo sapiens OX=9606 GN=RGS1 PE=1 SV=3
11	PDB:1agrE	0.563	0.947	1.578E-10	128	0.258	0.438	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
12	PDB:7shfC	0.573	0.316	1.054E-9	400	0.244	0.133	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
13	PDB:6pjxA	0.493	0.211	5.387E-5	543	0.134	0.053	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:3c4wB	0.459	0.207	9.812E-5	519	0.129	0.054	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:4mk0A	0.478	0.182	3.975E-4	631	0.106	0.036	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:3pvuA	0.466	0.183	1.457E-3	609	0.106	0.038	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:3nynA	0.492	0.207	2.402E-3	554	0.120	0.047	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
18	PDB:4gouA	0.468	0.212	2.525E-3	507	0.120	0.051	4gouA.pdb.gz
19	PDB:4yhjA	0.477	0.223	3.765E-3	501	0.120	0.052	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
20	PDB:3uzsA	0.476	0.186	5.342E-3	609	0.111	0.039	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49795	9.13e-162	447	217	1.000	1.000	RGS19_HUMAN Regulator of G-protein signaling 19 OS=Homo sapiens OX=9606 GN=RGS19 PE=1 SV=1
2	Q9CX84	1.85e-132	372	216	0.903	0.907	RGS19_MOUSE Regulator of G-protein signaling 19 OS=Mus musculus OX=10090 GN=Rgs19 PE=1 SV=1
3	O70521	6.39e-131	369	216	0.894	0.898	RGS19_RAT Regulator of G-protein signaling 19 OS=Rattus norvegicus OX=10116 GN=Rgs19 PE=1 SV=1
4	Q9QZB1	4.32e-73	223	239	0.488	0.444	RGS20_MOUSE Regulator of G-protein signaling 20 OS=Mus musculus OX=10090 GN=Rgs20 PE=1 SV=1
5	B1H233	6.95e-72	220	242	0.479	0.430	B1H233_RAT Rgs20 protein OS=Rattus norvegicus OX=10116 GN=Rgs20 PE=2 SV=1
6	G3V716	7.34e-72	220	242	0.479	0.430	G3V716_RAT Regulator of G-protein signaling 20 OS=Rattus norvegicus OX=10116 GN=Rgs20 PE=4 SV=1
7	A0A8I6GBE3	1.60e-71	219	255	0.479	0.408	A0A8I6GBE3_RAT Regulator of G-protein signaling 20 OS=Rattus norvegicus OX=10116 GN=Rgs20 PE=4 SV=1
8	O76081	1.91e-71	224	388	0.516	0.289	RGS20_HUMAN Regulator of G-protein signaling 20 OS=Homo sapiens OX=9606 GN=RGS20 PE=1 SV=4
9	Q9UGC6	1.05e-69	213	210	0.456	0.471	RGS17_HUMAN Regulator of G-protein signaling 17 OS=Homo sapiens OX=9606 GN=RGS17 PE=1 SV=2
10	F1M0G0	1.28e-68	211	210	0.429	0.443	F1M0G0_RAT Regulator of G-protein signaling 17 OS=Rattus norvegicus OX=10116 GN=Rgs17 PE=4 SV=2
11	A0A8I5ZV65	1.75e-68	211	228	0.429	0.408	A0A8I5ZV65_RAT Regulator of G-protein signaling 17 OS=Rattus norvegicus OX=10116 GN=Rgs17 PE=4 SV=1
12	Q9QZB0	1.87e-68	210	210	0.424	0.438	RGS17_MOUSE Regulator of G-protein signaling 17 OS=Mus musculus OX=10090 GN=Rgs17 PE=1 SV=1
13	A0A0B4LFL6	1.66e-64	202	271	0.429	0.343	A0A0B4LFL6_DROME Double hit, isoform C OS=Drosophila melanogaster OX=7227 GN=Dhit PE=4 SV=1
14	Q8T017	2.30e-64	202	274	0.429	0.339	Q8T017_DROME Double hit, isoform B OS=Drosophila melanogaster OX=7227 GN=Dhit PE=1 SV=1
15	O96842	5.69e-60	190	244	0.387	0.344	O96842_DROME EG:52C10.2 protein OS=Drosophila melanogaster OX=7227 GN=Dhit PE=4 SV=1
16	G5ECA3	1.56e-54	173	162	0.369	0.494	G5ECA3_CAEEL RGS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rgs-2 PE=4 SV=1
17	G5EFC5	3.11e-54	172	167	0.369	0.479	G5EFC5_CAEEL RGS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rgs-2 PE=4 SV=1
18	P49808	4.70e-54	172	169	0.401	0.515	RGS2_CAEEL Regulator of G-protein signaling rgs-2 OS=Caenorhabditis elegans OX=6239 GN=rgs-2 PE=1 SV=1
19	G5EFV0	7.46e-54	172	181	0.369	0.442	G5EFV0_CAEEL RGS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rgs-2 PE=4 SV=1
20	P34295	8.33e-52	167	201	0.401	0.433	RGS1_CAEEL Regulator of G-protein signaling rgs-1 OS=Caenorhabditis elegans OX=6239 GN=rgs-1 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00615 RGS	2.2e-31	120.0	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378483

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376753	0.999	PDZ domain-containing protein GIPC1
2	9606.ENSP00000478892	0.984	Guanine nucleotide-binding protein G(z) subunit alpha
3	9606.ENSP00000431418	0.980	High affinity nerve growth factor receptor
4	9606.ENSP00000358867	0.978	Guanine nucleotide-binding protein G(k) subunit alpha
5	9606.ENSP00000262494	0.928	Guanine nucleotide-binding protein G(o) subunit alpha
6	9606.ENSP00000297313	0.923	Regulator of G-protein signaling 20
7	9606.ENSP00000358099	0.918	Regulator of G-protein signaling 10
8	9606.ENSP00000386229	0.917	Regulator of G-protein signaling 14
9	9606.ENSP00000312999	0.916	Guanine nucleotide-binding protein G(i) subunit alpha-2
10	9606.ENSP00000355523	0.916	Regulator of G-protein signaling 7
11	9606.ENSP00000356430	0.915	Regulator of G-protein signaling 18
12	9606.ENSP00000397181	0.914	Regulator of G-protein signaling 4
13	9606.ENSP00000451030	0.914	Regulator of G-protein signaling 6
14	9606.ENSP00000339381	0.913	Regulator of G-protein signaling 12
15	9606.ENSP00000356429	0.912	Regulator of G-protein signaling 1
16	9606.ENSP00000235382	0.910	Regulator of G-protein signaling 2
17	9606.ENSP00000258302	0.910	Regulator of G-protein signaling 8
18	9606.ENSP00000358525	0.910	Beta-nerve growth factor
19	9606.ENSP00000363255	0.910	Regulator of G-protein signaling 3
20	9606.ENSP00000380876	0.910	Regulator of G-protein signaling 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0016817	0.997	hydrolase activity, acting on acid anhydrides
GO:0003924	0.975	GTPase activity
GO:0001965	0.751	G-protein alpha-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0007165	0.980	signal transduction
GO:0007186	0.957	G protein-coupled receptor signaling pathway
GO:0042221	0.691	response to chemical
GO:0010033	0.676	response to organic substance
GO:0048583	0.536	regulation of response to stimulus
GO:0009966	0.528	regulation of signal transduction
GO:0007264	0.345	small GTPase mediated signal transduction
GO:0008277	0.338	regulation of G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005794	0.990	Golgi apparatus
GO:0005886	0.988	plasma membrane
GO:0031982	0.645	vesicle
GO:0098588	0.356	bounding membrane of organelle
GO:0031410	0.341	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.-.-	0.997	Acting on acid anhydrides.
RHEA:19669	0.975	GTP + H2O = GDP + H(+) + phosphate

[back to server]