StarFunc result for job id P49796

User Input

>input (1198 residues)
MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQD
SLPFGRRLYSGPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEW
TQTSPARKRITHAKVQGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIP
EDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSF
GVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDTENGKKLKI
TIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHE
IRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQ
RHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQL
LRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSY
GTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTK
EDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWC
LSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQ
DLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQ
DLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLL
AATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDE
DTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDT
TLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASR
KRKSKNLAKDMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVH
KYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNL
DSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49796	1.000	1.000	0.000	1198	1.000	1.000	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
2	PDB:3pfqA	0.114	0.257	1.497E-13	523	0.043	0.098	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
3	PDB:1agrE	0.106	0.974	9.800E-13	128	0.064	0.602	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
4	AFDB:Q99NE5	0.104	0.087	1.905E-11	1463	0.127	0.104	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
5	PDB:7shfC	0.107	0.316	1.462E-9	400	0.043	0.128	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
6	AFDB:Q14005	0.067	0.060	5.634E-9	1332	0.139	0.125	Q14005.pdb.gz	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
7	AFDB:Q9CSB4	0.080	0.080	2.825E-7	1203	0.098	0.097	Q9CSB4.pdb.gz	PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2
8	AFDB:Q9UPX8	0.074	0.064	7.615E-7	1470	0.142	0.116	Q9UPX8.pdb.gz	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
9	AFDB:Q4KWH5	0.073	0.054	1.755E-6	1682	0.125	0.089	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
10	AFDB:Q4KWH8	0.070	0.051	2.665E-6	1693	0.119	0.084	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
11	PDB:5ixcA	0.075	0.127	5.025E-6	684	0.033	0.057	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:7pe9I	0.068	0.251	1.853E-5	317	0.023	0.088	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
13	PDB:4rj9A	0.072	0.467	2.534E-5	161	0.025	0.186	4rj9A.pdb.gz
14	PDB:5izrC	0.073	0.128	2.670E-5	659	0.022	0.039	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	AFDB:D1MYR8	0.089	0.105	3.623E-5	1007	0.057	0.068	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1
16	PDB:1cjyA	0.075	0.137	3.652E-5	633	0.016	0.030	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
17	AFDB:F1QJ05	0.069	0.057	4.238E-5	1509	0.162	0.129	F1QJ05.pdb.gz
18	PDB:3c4wB	0.096	0.210	6.485E-5	519	0.027	0.062	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	AFDB:Q9JLU4	0.066	0.046	6.779E-5	1740	0.129	0.089	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
20	PDB:5iz5B	0.074	0.116	7.584E-5	746	0.021	0.034	5iz5B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49796	0.0	2457	1198	1.000	1.000	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
2	P49797	0.0	1427	967	0.631	0.782	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
3	Q5VXC0	0.0	610	340	0.256	0.903	Q5VXC0_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
4	Q9DC04	0.0	1402	966	0.624	0.774	RGS3_MOUSE Regulator of G-protein signaling 3 OS=Mus musculus OX=10090 GN=Rgs3 PE=1 SV=2
5	A0A087WUY2	6.74e-115	357	192	0.144	0.896	A0A087WUY2_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
6	Q6DC84	7.99e-90	288	173	0.109	0.757	Q6DC84_DANRE Regulator of G protein-signaling 3a OS=Danio rerio OX=7955 GN=zgc:100933 PE=2 SV=1
7	Q9JHX0	8.00e-53	186	211	0.073	0.417	RGS2_RAT Regulator of G-protein signaling 2 OS=Rattus norvegicus OX=10116 GN=Rgs2 PE=2 SV=1
8	P41220	1.18e-52	186	211	0.074	0.422	RGS2_HUMAN Regulator of G-protein signaling 2 OS=Homo sapiens OX=9606 GN=RGS2 PE=1 SV=1
9	P49798	2.85e-52	184	205	0.074	0.434	RGS4_HUMAN Regulator of G-protein signaling 4 OS=Homo sapiens OX=9606 GN=RGS4 PE=1 SV=1
10	P49799	2.94e-52	184	205	0.074	0.434	RGS4_RAT Regulator of G-protein signaling 4 OS=Rattus norvegicus OX=10116 GN=Rgs4 PE=1 SV=1
11	O08899	6.07e-52	183	205	0.073	0.429	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
12	O08849	6.58e-52	183	211	0.073	0.412	RGS2_MOUSE Regulator of G-protein signaling 2 OS=Mus musculus OX=10090 GN=Rgs2 PE=2 SV=2
13	P57771	2.83e-50	177	180	0.073	0.489	RGS8_HUMAN Regulator of G-protein signaling 8 OS=Homo sapiens OX=9606 GN=RGS8 PE=1 SV=1
14	Q8BXT1	2.97e-50	177	180	0.073	0.483	RGS8_MOUSE Regulator of G-protein signaling 8 OS=Mus musculus OX=10090 GN=Rgs8 PE=1 SV=1
15	P49804	9.39e-50	176	180	0.072	0.478	RGS8_RAT Regulator of G-protein signaling 8 OS=Rattus norvegicus OX=10116 GN=Rgs8 PE=1 SV=2
16	B1APM2	4.51e-48	172	201	0.073	0.438	B1APM2_HUMAN Regulator of G-protein signaling 5 OS=Homo sapiens OX=9606 GN=RGS5 PE=1 SV=1
17	O15539	4.98e-48	171	181	0.073	0.486	RGS5_HUMAN Regulator of G-protein signaling 5 OS=Homo sapiens OX=9606 GN=RGS5 PE=1 SV=1
18	P49800	5.86e-48	171	181	0.073	0.486	RGS5_RAT Regulator of G-protein signaling 5 OS=Rattus norvegicus OX=10116 GN=Rgs5 PE=2 SV=2
19	O08850	4.39e-47	168	181	0.073	0.481	RGS5_MOUSE Regulator of G-protein signaling 5 OS=Mus musculus OX=10090 GN=Rgs5 PE=2 SV=2
20	P97428	6.81e-47	169	201	0.076	0.453	RGS16_MOUSE Regulator of G-protein signaling 16 OS=Mus musculus OX=10090 GN=Rgs16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.5e-11	55.1	C2 domain
2	PF15627 CEP76-C2	6.2	17.9	CEP76 C2 domain
3	PF00595 PDZ	0.0029	29.3	PDZ domain
4	PF13180 PDZ_2	2.3	20.0	PDZ domain
5	PF17820 PDZ_6	0.22	22.8	PDZ domain
6	PF02163 Peptidase_M50	0.55	21.0	Peptidase family M50
7	PF00615 RGS	1.3e-32	124.0	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204961	0.963	Ephrin-B1
2	9606.ENSP00000355523	0.930	Regulator of G-protein signaling 7
3	9606.ENSP00000381097	0.930	Ephrin type-B receptor 1
4	9606.ENSP00000451030	0.929	Regulator of G-protein signaling 6
5	9606.ENSP00000245323	0.928	Ephrin-B2
6	9606.ENSP00000339381	0.928	Regulator of G-protein signaling 12
7	9606.ENSP00000386229	0.928	Regulator of G-protein signaling 14
8	9606.ENSP00000380876	0.927	Regulator of G-protein signaling 11
9	9606.ENSP00000312999	0.924	Guanine nucleotide-binding protein G(i) subunit alpha-2
10	9606.ENSP00000363763	0.924	Ephrin type-B receptor 2
11	9606.ENSP00000297313	0.922	Regulator of G-protein signaling 20
12	9606.ENSP00000358867	0.920	Guanine nucleotide-binding protein G(k) subunit alpha
13	9606.ENSP00000262406	0.917	Regulator of G-protein signaling 9
14	9606.ENSP00000358099	0.911	Regulator of G-protein signaling 10
15	9606.ENSP00000397181	0.911	Regulator of G-protein signaling 4
16	9606.ENSP00000378483	0.910	Regulator of G-protein signaling 19
17	9606.ENSP00000356194	0.909	Regulator of G-protein signaling 17
18	9606.ENSP00000356429	0.908	Regulator of G-protein signaling 1
19	9606.ENSP00000356430	0.908	Regulator of G-protein signaling 18
20	9606.ENSP00000379287	0.907	14-3-3 protein zeta/delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0003924	0.999	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050789	0.995	regulation of biological process
GO:0007154	0.995	cell communication
GO:0007186	0.988	G protein-coupled receptor signaling pathway
GO:0009966	0.979	regulation of signal transduction
GO:0008277	0.952	regulation of G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005829	0.989	cytosol
GO:0043227	0.767	membrane-bounded organelle
GO:0043231	0.722	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.999	GTP + H2O = GDP + H(+) + phosphate

[back to server]