StarFunc result for job id P49798

User Input

>input (205 residues)
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08899	0.834	0.834	5.467E-27	205	0.956	0.956	O08899.pdb.gz	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
2	PDB:1agrE	0.618	0.988	3.061E-16	128	0.615	0.984	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
3	AFDB:A8WGN3	0.638	0.609	9.411E-16	215	0.493	0.470	A8WGN3.pdb.gz
4	AFDB:Q6DC84	0.651	0.768	1.335E-14	173	0.434	0.514	Q6DC84.pdb.gz	Q6DC84_DANRE Regulator of G protein-signaling 3a OS=Danio rerio OX=7955 GN=zgc:100933 PE=2 SV=1
5	AFDB:Q9NS28	0.635	0.556	2.434E-14	235	0.410	0.357	Q9NS28.pdb.gz	RGS18_HUMAN Regulator of G-protein signaling 18 OS=Homo sapiens OX=9606 GN=RGS18 PE=1 SV=1
6	AFDB:P49804	0.658	0.748	3.286E-14	180	0.439	0.500	P49804.pdb.gz	RGS8_RAT Regulator of G-protein signaling 8 OS=Rattus norvegicus OX=10116 GN=Rgs8 PE=1 SV=2
7	AFDB:Q08BE2	0.643	0.634	4.014E-14	208	0.371	0.365	Q08BE2.pdb.gz	Q08BE2_DANRE Regulator of G-protein signaling 18 OS=Danio rerio OX=7955 GN=zgc:153888 PE=2 SV=1
8	AFDB:P49797	0.650	0.148	4.664E-14	967	0.439	0.093	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
9	AFDB:P49796	0.645	0.115	5.155E-14	1198	0.439	0.075	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
10	AFDB:Q99PG4	0.645	0.566	9.398E-14	235	0.395	0.345	Q99PG4.pdb.gz	RGS18_MOUSE Regulator of G-protein signaling 18 OS=Mus musculus OX=10090 GN=Rgs18 PE=1 SV=1
11	AFDB:P97428	0.610	0.622	1.334E-13	201	0.415	0.423	P97428.pdb.gz	RGS16_MOUSE Regulator of G-protein signaling 16 OS=Mus musculus OX=10090 GN=Rgs16 PE=1 SV=1
12	PDB:7shfC	0.602	0.315	1.176E-8	400	0.220	0.113	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
13	PDB:3c4wB	0.492	0.210	1.173E-4	519	0.112	0.044	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:6pjxA	0.517	0.208	1.234E-4	543	0.112	0.042	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:4mk0A	0.483	0.171	7.109E-4	631	0.093	0.030	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:4gouA	0.484	0.203	9.599E-4	507	0.127	0.051	4gouA.pdb.gz
17	PDB:3pvuA	0.492	0.181	2.138E-3	609	0.102	0.034	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:3uzsA	0.487	0.180	4.528E-3	609	0.107	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:4yhjA	0.505	0.222	6.758E-3	501	0.093	0.038	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
20	PDB:3nynA	0.516	0.205	8.255E-3	554	0.078	0.029	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49798	1.11e-151	420	205	1.000	1.000	RGS4_HUMAN Regulator of G-protein signaling 4 OS=Homo sapiens OX=9606 GN=RGS4 PE=1 SV=1
2	P49799	1.28e-147	410	205	0.971	0.971	RGS4_RAT Regulator of G-protein signaling 4 OS=Rattus norvegicus OX=10116 GN=Rgs4 PE=1 SV=1
3	O08899	1.77e-145	404	205	0.956	0.956	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
4	O15539	5.37e-63	195	181	0.468	0.530	RGS5_HUMAN Regulator of G-protein signaling 5 OS=Homo sapiens OX=9606 GN=RGS5 PE=1 SV=1
5	P49800	1.01e-61	192	181	0.468	0.530	RGS5_RAT Regulator of G-protein signaling 5 OS=Rattus norvegicus OX=10116 GN=Rgs5 PE=2 SV=2
6	Q6TEM0	1.68e-61	192	215	0.488	0.465	Q6TEM0_DANRE Regulator of G-protein signaling 4 OS=Danio rerio OX=7955 GN=RGS4 PE=2 SV=1
7	O08850	4.41e-61	190	181	0.463	0.525	RGS5_MOUSE Regulator of G-protein signaling 5 OS=Mus musculus OX=10090 GN=Rgs5 PE=2 SV=2
8	Q8BXT1	1.20e-59	186	180	0.434	0.494	RGS8_MOUSE Regulator of G-protein signaling 8 OS=Mus musculus OX=10090 GN=Rgs8 PE=1 SV=1
9	P49804	4.13e-59	185	180	0.429	0.489	RGS8_RAT Regulator of G-protein signaling 8 OS=Rattus norvegicus OX=10116 GN=Rgs8 PE=1 SV=2
10	P57771	1.88e-58	183	180	0.424	0.483	RGS8_HUMAN Regulator of G-protein signaling 8 OS=Homo sapiens OX=9606 GN=RGS8 PE=1 SV=1
11	A0A087WUY2	2.71e-58	183	192	0.434	0.464	A0A087WUY2_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
12	Q6DC84	3.44e-57	180	173	0.424	0.503	Q6DC84_DANRE Regulator of G protein-signaling 3a OS=Danio rerio OX=7955 GN=zgc:100933 PE=2 SV=1
13	B1APM2	4.03e-53	171	201	0.415	0.423	B1APM2_HUMAN Regulator of G-protein signaling 5 OS=Homo sapiens OX=9606 GN=RGS5 PE=1 SV=1
14	P49796	4.31e-53	184	1198	0.434	0.074	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
15	Q9DC04	5.75e-52	181	966	0.429	0.091	RGS3_MOUSE Regulator of G-protein signaling 3 OS=Mus musculus OX=10090 GN=Rgs3 PE=1 SV=2
16	P49797	5.99e-52	181	967	0.429	0.091	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
17	P97428	2.49e-51	166	201	0.439	0.448	RGS16_MOUSE Regulator of G-protein signaling 16 OS=Mus musculus OX=10090 GN=Rgs16 PE=1 SV=1
18	O15492	7.28e-51	165	202	0.444	0.450	RGS16_HUMAN Regulator of G-protein signaling 16 OS=Homo sapiens OX=9606 GN=RGS16 PE=1 SV=2
19	P56700	1.71e-50	164	199	0.410	0.422	RGS16_RAT Regulator of G-protein signaling 16 OS=Rattus norvegicus OX=10116 GN=Rgs16 PE=2 SV=1
20	Q9NS28	4.00e-48	159	235	0.390	0.340	RGS18_HUMAN Regulator of G-protein signaling 18 OS=Homo sapiens OX=9606 GN=RGS18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00615 RGS	3.3e-32	122.7	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000006859

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000035024	0.970	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1
2	9544.ENSMMUP00000028853	0.963	Guanine nucleotide-binding protein G(Q) subunit alpha
3	9544.ENSMMUP00000007669	0.915	Guanine nucleotide-binding protein G(K) subunit alpha
4	9544.ENSMMUP00000026158	0.907	Guanine nucleotide-binding protein G(O) subunit alpha isoform a
5	9544.ENSMMUP00000003957	0.897	Guanine nucleotide-binding protein subunit alpha-11
6	9544.ENSMMUP00000026481	0.864	Uncharacterized protein
7	9544.ENSMMUP00000039731	0.763	Regulator of G protein signaling 3
8	9544.ENSMMUP00000006862	0.759	Regulator of G-protein signaling 5
9	9544.ENSMMUP00000007670	0.759	G protein subunit alpha transducin 2
10	9544.ENSMMUP00000013546	0.759	Uncharacterized protein
11	9544.ENSMMUP00000009387	0.741	Regulator of G protein signaling 12
12	9544.ENSMMUP00000002367	0.727	Guanine nucleotide-binding protein G(Z) subunit alpha
13	9544.ENSMMUP00000028465	0.719	Regulator of G-protein signaling 10 isoform a
14	9544.ENSMMUP00000025082	0.715	Regulator of G protein signaling 17
15	9544.ENSMMUP00000020223	0.707	Regulator of G-protein signaling 20
16	9544.ENSMMUP00000032761	0.707	Uncharacterized protein
17	9544.ENSMMUP00000014057	0.704	Regulator of G-protein signaling 7
18	9544.ENSMMUP00000026044	0.704	Regulator of G-protein signaling 14
19	9544.ENSMMUP00000004650	0.702	Regulator of G-protein signaling 1
20	9544.ENSMMUP00000022669	0.701	Regulator of G-protein signaling 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.999	protein binding
GO:0003824	0.930	catalytic activity
GO:0016462	0.855	pyrophosphatase activity
GO:0003924	0.845	GTPase activity
GO:0019899	0.333	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.987	signal transduction
GO:0007186	0.980	G protein-coupled receptor signaling pathway
GO:0023051	0.862	regulation of signaling
GO:0010646	0.862	regulation of cell communication
GO:0009966	0.854	regulation of signal transduction
GO:0008277	0.653	regulation of G protein-coupled receptor signaling pathway
GO:0048519	0.439	negative regulation of biological process
GO:0048523	0.426	negative regulation of cellular process
GO:0065009	0.387	regulation of molecular function
GO:0042221	0.315	response to chemical
GO:0050790	0.307	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043226	0.998	organelle
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005634	0.973	nucleus
GO:0032991	0.908	protein-containing complex
GO:0005829	0.847	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.855	In phosphorus-containing anhydrides.
RHEA:19669	0.845	GTP + H2O = GDP + H(+) + phosphate

[back to server]