StarFunc result for job id P49802

User Input

>input (495 residues)
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49802	1.000	1.000	4.632E-74	495	1.000	1.000	P49802.pdb.gz	RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens OX=9606 GN=RGS7 PE=1 SV=3
2	AFDB:P49758	0.839	0.880	4.972E-55	472	0.679	0.712	P49758.pdb.gz	RGS6_HUMAN Regulator of G-protein signaling 6 OS=Homo sapiens OX=9606 GN=RGS6 PE=1 SV=5
3	PDB:7shfC	0.777	0.958	1.057E-50	400	0.800	0.990	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
4	AFDB:A0A0A0MRA9	0.629	0.738	1.048E-45	418	0.610	0.722	A0A0A0MRA9.pdb.gz	A0A0A0MRA9_HUMAN Regulator of G protein signaling 6 OS=Homo sapiens OX=9606 GN=RGS6 PE=1 SV=1
5	AFDB:F5GUC9	0.788	0.614	6.974E-41	639	0.511	0.396	F5GUC9.pdb.gz	F5GUC9_CAEEL Regulator of G-protein signaling egl-10 OS=Caenorhabditis elegans OX=6239 GN=egl-10 PE=1 SV=1
6	AFDB:Q9Z2H1	0.720	0.801	1.290E-35	443	0.337	0.377	Q9Z2H1.pdb.gz	RGS11_MOUSE Regulator of G-protein signaling 11 OS=Mus musculus OX=10090 GN=Rgs11 PE=1 SV=2
7	AFDB:P49805	0.726	0.538	1.483E-35	677	0.362	0.264	P49805.pdb.gz	RGS9_RAT Regulator of G-protein signaling 9 OS=Rattus norvegicus OX=10116 GN=Rgs9 PE=2 SV=3
8	AFDB:O46469	0.731	0.746	4.123E-35	484	0.354	0.362	O46469.pdb.gz	RGS9_BOVIN Regulator of G-protein signaling 9 OS=Bos taurus OX=9913 GN=RGS9 PE=1 SV=1
9	AFDB:O94810	0.740	0.782	8.279E-35	467	0.339	0.360	O94810.pdb.gz	RGS11_HUMAN Regulator of G-protein signaling 11 OS=Homo sapiens OX=9606 GN=RGS11 PE=1 SV=2
10	AFDB:O17589	0.735	0.767	1.141E-32	473	0.323	0.338	O17589.pdb.gz	O17589_CAEEL Regulator of G-protein signaling 7 OS=Caenorhabditis elegans OX=6239 GN=eat-16 PE=1 SV=2
11	AFDB:Q6DC84	0.272	0.749	2.741E-10	173	0.123	0.353	Q6DC84.pdb.gz	Q6DC84_DANRE Regulator of G protein-signaling 3a OS=Danio rerio OX=7955 GN=zgc:100933 PE=2 SV=1
12	PDB:1agrE	0.248	0.933	4.231E-8	128	0.091	0.352	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
13	PDB:6pjxA	0.220	0.201	3.171E-4	543	0.048	0.044	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
14	PDB:3c4wB	0.227	0.217	7.668E-4	519	0.059	0.056	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
15	PDB:7pe9I	0.165	0.252	3.553E-3	317	0.061	0.095	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
16	PDB:3pvuA	0.214	0.176	5.655E-3	609	0.048	0.039	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:7rx9A	0.158	0.180	6.206E-3	432	0.051	0.058	7rx9A.pdb.gz
18	PDB:4gouA	0.201	0.196	6.811E-3	507	0.053	0.051	4gouA.pdb.gz
19	PDB:4mk0A	0.212	0.170	7.474E-3	631	0.057	0.044	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:3nynA	0.212	0.191	7.829E-3	554	0.046	0.042	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRA9	0.0	639	418	0.614	0.727	A0A0A0MRA9_HUMAN Regulator of G protein signaling 6 OS=Homo sapiens OX=9606 GN=RGS6 PE=1 SV=1
2	O54829	0.0	940	469	0.905	0.955	RGS7_MOUSE Regulator of G-protein signaling 7 OS=Mus musculus OX=10090 GN=Rgs7 PE=1 SV=2
3	P49758	0.0	726	472	0.681	0.714	RGS6_HUMAN Regulator of G-protein signaling 6 OS=Homo sapiens OX=9606 GN=RGS6 PE=1 SV=5
4	P49802	0.0	1036	495	1.000	1.000	RGS7_HUMAN Regulator of G-protein signaling 7 OS=Homo sapiens OX=9606 GN=RGS7 PE=1 SV=3
5	P49803	0.0	978	477	0.949	0.985	RGS7_RAT Regulator of G-protein signaling 7 OS=Rattus norvegicus OX=10116 GN=Rgs7 PE=1 SV=2
6	Q9Z2H2	0.0	734	472	0.687	0.720	RGS6_MOUSE Regulator of G-protein signaling 6 OS=Mus musculus OX=10090 GN=Rgs6 PE=1 SV=2
7	P49809	8.82e-109	336	555	0.301	0.268	EGL10_CAEEL Regulator of G-protein signaling egl-10 OS=Caenorhabditis elegans OX=6239 GN=egl-10 PE=1 SV=1
8	F5GUC9	1.06e-108	338	639	0.301	0.233	F5GUC9_CAEEL Regulator of G-protein signaling egl-10 OS=Caenorhabditis elegans OX=6239 GN=egl-10 PE=1 SV=1
9	F5GUD0	2.29e-108	335	585	0.301	0.255	F5GUD0_CAEEL Regulator of G-protein signaling egl-10 OS=Caenorhabditis elegans OX=6239 GN=egl-10 PE=1 SV=1
10	Q9Z2H1	2.47e-104	320	443	0.337	0.377	RGS11_MOUSE Regulator of G-protein signaling 11 OS=Mus musculus OX=10090 GN=Rgs11 PE=1 SV=2
11	O46469	6.79e-104	321	484	0.358	0.366	RGS9_BOVIN Regulator of G-protein signaling 9 OS=Bos taurus OX=9913 GN=RGS9 PE=1 SV=1
12	P49805	2.73e-102	322	677	0.349	0.256	RGS9_RAT Regulator of G-protein signaling 9 OS=Rattus norvegicus OX=10116 GN=Rgs9 PE=2 SV=3
13	O54828	3.50e-101	320	675	0.347	0.255	RGS9_MOUSE Regulator of G-protein signaling 9 OS=Mus musculus OX=10090 GN=Rgs9 PE=1 SV=3
14	O75916	4.22e-101	319	674	0.335	0.246	RGS9_HUMAN Regulator of G-protein signaling 9 OS=Homo sapiens OX=9606 GN=RGS9 PE=1 SV=1
15	O94810	8.19e-101	312	467	0.327	0.347	RGS11_HUMAN Regulator of G-protein signaling 11 OS=Homo sapiens OX=9606 GN=RGS11 PE=1 SV=2
16	Q8T3F0	6.96e-95	296	431	0.335	0.385	Q8T3F0_CAEEL Regulator of G-protein signaling 7 OS=Caenorhabditis elegans OX=6239 GN=eat-16 PE=1 SV=1
17	O17589	2.91e-94	295	473	0.335	0.351	O17589_CAEEL Regulator of G-protein signaling 7 OS=Caenorhabditis elegans OX=6239 GN=eat-16 PE=1 SV=2
18	P49801	5.60e-30	113	66	0.105	0.788	RGS6_RAT Regulator of G-protein signaling 6 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rgs6 PE=2 SV=1
19	V9GXQ3	2.92e-26	106	152	0.103	0.336	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
20	A0A5S9EHU3	3.33e-26	105	147	0.107	0.361	A0A5S9EHU3_MOUSE Regulator of G protein Signaling 21 variant 2 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	1.1e-14	65.5	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF00631 G-gamma	1.6e-12	58.5	GGL domain
3	PF00615 RGS	8.7e-32	121.3	Regulator of G protein signaling domain
4	PF18148 RGS_DHEX	3.3e-47	170.0	Regulator of G-protein signalling DHEX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000011026

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000012110	0.989	Guanine nucleotide binding protein (G protein), beta 5
2	9598.ENSPTRP00000018478	0.901	Regulator of G protein signaling 9 binding protein
3	9598.ENSPTRP00000011247	0.896	Echinoderm microtubule associated protein like 5
4	9598.ENSPTRP00000013873	0.875	G protein subunit alpha o1
5	9598.ENSPTRP00000042942	0.866	Transporter
6	9598.ENSPTRP00000043879	0.865	CREB regulated transcription coactivator 3
7	9598.ENSPTRP00000055480	0.836	Phosphodiesterase
8	9598.ENSPTRP00000046803	0.790	DNA topoisomerase
9	9598.ENSPTRP00000028969	0.761	Regulator of G-protein signaling 7 binding protein
10	9598.ENSPTRP00000033088	0.746	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1
11	9598.ENSPTRP00000025802	0.743	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2
12	9598.ENSPTRP00000002692	0.732	Regulator of G-protein signaling 4
13	9598.ENSPTRP00000002285	0.731	SNARE-associated protein Snapin
14	9598.ENSPTRP00000035622	0.716	ELAV-like protein
15	9598.ENSPTRP00000001821	0.714	Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3
16	9598.ENSPTRP00000004009	0.711	G protein-coupled receptor 158
17	9598.ENSPTRP00000013195	0.710	ZNF500
18	9598.ENSPTRP00000027323	0.709	Regulator of G-protein signaling 12
19	9598.ENSPTRP00000039442	0.707	RAP1A, member of RAS oncogene family
20	9598.ENSPTRP00000034678	0.703	Regulator of G-protein signaling 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0003924	0.994	GTPase activity
GO:0031681	0.975	G-protein beta-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.983	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0051716	0.969	cellular response to stimulus
GO:0007186	0.888	G protein-coupled receptor signaling pathway
GO:0044093	0.751	positive regulation of molecular function
GO:0043087	0.727	regulation of GTPase activity
GO:0042221	0.627	response to chemical
GO:0010243	0.615	response to organonitrogen compound
GO:1901700	0.606	response to oxygen-containing compound
GO:0071417	0.543	cellular response to organonitrogen compound
GO:1901701	0.524	cellular response to oxygen-containing compound
GO:0071407	0.480	cellular response to organic cyclic compound
GO:0008277	0.391	regulation of G protein-coupled receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0005886	0.998	plasma membrane
GO:0005829	0.985	cytosol
GO:0043226	0.972	organelle
GO:0043229	0.959	intracellular organelle
GO:0043227	0.957	membrane-bounded organelle
GO:0005634	0.935	nucleus
GO:0043005	0.342	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.994	GTP + H2O = GDP + H(+) + phosphate

[back to server]