StarFunc result for job id P49815

User Input

>input (1807 residues)
MAKPTSKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRELSMECGLNNRIRM
IGQICEVAKTKKFEEHAVEALWKAVADLLQPERPLEARHAVLALLKAIVQGQGERLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLLVL
VNLVKFNSCYLDEYIARMVQMICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLRNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDI
LLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGAVRIKVLDVLSFVLLINRQFY
EEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARSLS
PPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKH
SYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKKTS
GPLSPPTGPPGPAPAGPAVRLGSVPYSLLFRVLLQCLKQESDWKVLKLVLGRLPESLRYK
VLIFTSPCSVDQLCSALCSMLSGPKTLERLRGAPEGFSRTDLHLAVVPVLTALISYHNYL
DKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIIIKALPVLVVKLTHISATASMA
VPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRVG
ALDVPASQFLGSATSPGPRTAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAST
AKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEGSPGEVPVLVEPPGLEDV
EAALGMDRRTDAYSRSSSVSSQEEKSLHAEELVGRGIPIERVVSSEGGRPSVDLSFQPSQ
PLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQSGTLDGESAAWSASGEDSRGQ
PEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFV
FLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELA
ILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFH
IATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIVTPLDYEC
NLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKW
IARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSV
EDFTEFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49815	1.000	1.000	0.000	1807	1.000	1.000	P49815.pdb.gz	TSC2_HUMAN Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2
2	AFDB:Q61037	0.801	0.799	0.000	1814	0.890	0.887	Q61037.pdb.gz	TSC2_MOUSE Tuberin OS=Mus musculus OX=10090 GN=Tsc2 PE=1 SV=1
3	AFDB:Q9VW83	0.618	0.605	1.844E-90	1847	0.312	0.305	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
4	PDB:7dl2A	0.536	0.832	2.353E-88	1127	0.617	0.989	7dl2A.pdb.gz
5	PDB:7dl2B	0.485	0.805	1.310E-78	1042	0.573	0.993	7dl2B.pdb.gz
6	AFDB:Q5UIP0	0.152	0.125	2.519E-13	2472	0.110	0.081	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
7	AFDB:E1C2U2	0.167	0.143	5.832E-13	2326	0.108	0.084	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
8	AFDB:P29539	0.131	0.126	4.758E-12	1916	0.117	0.110	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
9	AFDB:F4IAT2	0.084	0.084	4.757E-9	1823	0.116	0.115	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
10	PDB:6xu2A	0.147	0.221	1.617E-8	1091	0.061	0.101	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
11	PDB:4a0cA	0.096	0.127	1.956E-8	1155	0.072	0.113	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
12	PDB:7unkA	0.136	0.220	4.889E-8	1047	0.068	0.117	7unkA.pdb.gz
13	AFDB:Q9VW47	0.103	0.084	6.134E-8	2531	0.120	0.085	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
14	PDB:6ahoA	0.142	0.235	9.718E-8	916	0.061	0.120	6ahoA.pdb.gz
15	PDB:6zwmB	0.096	0.083	1.423E-7	2185	0.066	0.055	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
16	PDB:3w3zA	0.138	0.221	1.859E-7	1013	0.061	0.109	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
17	PDB:7mqaLM	0.145	0.134	3.054E-7	2041	0.084	0.074	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:2xwuB	0.110	0.173	4.144E-7	910	0.062	0.123	2xwuB.pdb.gz
19	AFDB:A0A0G2JZW4	0.082	0.069	1.073E-6	2308	0.107	0.084	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
20	AFDB:A2A690	0.089	0.083	9.098E-6	1994	0.139	0.126	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KHX4	0.0	2013	1674	0.581	0.627	A0A0G2KHX4_DANRE TSC complex subunit 2 OS=Danio rerio OX=7955 GN=fc16b02 PE=1 SV=1
2	A0A2R8Y5F1	0.0	3538	1738	0.962	1.000	A0A2R8Y5F1_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
3	A0A2R8Y6C9	0.0	2781	1359	0.752	0.999	A0A2R8Y6C9_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
4	A0A2R8Y7C8	0.0	3647	1782	0.986	1.000	A0A2R8Y7C8_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
5	A0A2R8Y7X5	0.0	3528	1769	0.963	0.984	A0A2R8Y7X5_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
6	A0A2R8YDR3	0.0	3643	1781	0.985	0.999	A0A2R8YDR3_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
7	A0A2R8YDZ2	0.0	3593	1760	0.974	1.000	A0A2R8YDZ2_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
8	A0A2R8YGD6	0.0	3709	1805	0.999	1.000	A0A2R8YGD6_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
9	A0A2R8YGU4	0.0	3539	1739	0.962	1.000	A0A2R8YGU4_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
10	H3BMQ0	0.0	3548	1751	0.963	0.994	H3BMQ0_HUMAN TSC complex subunit 2 OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
11	P49815	0.0	3719	1807	1.000	1.000	TSC2_HUMAN Tuberin OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=2
12	P49816	0.0	3255	1809	0.911	0.910	TSC2_RAT Tuberin OS=Rattus norvegicus OX=10116 GN=Tsc2 PE=1 SV=1
13	Q61037	0.0	3136	1814	0.892	0.889	TSC2_MOUSE Tuberin OS=Mus musculus OX=10090 GN=Tsc2 PE=1 SV=1
14	X5D2U8	0.0	3548	1741	0.963	1.000	X5D2U8_HUMAN TSC complex subunit 2 (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=1 SV=1
15	X5D7Q2	0.0	3546	1740	0.963	1.000	X5D7Q2_HUMAN Tuberous sclerosis 2 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=TSC2 PE=2 SV=1
16	Q9VW83	7.77e-166	555	1847	0.216	0.212	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
17	Q7K0T0	4.54e-165	553	1876	0.216	0.208	Q7K0T0_DROME LD36178p (Fragment) OS=Drosophila melanogaster OX=7227 GN=gig PE=2 SV=1
18	M9PD17	2.51e-164	551	1844	0.216	0.211	M9PD17_DROME Gigas, isoform B OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
19	Q9U9B0	9.32e-164	549	1847	0.216	0.211	Q9U9B0_DROME Gigas protein OS=Drosophila melanogaster OX=7227 GN=gig PE=2 SV=1
20	Q54VB2	2.96e-56	219	2935	0.072	0.045	Q54VB2_DICDI RapGAP/RanGAP domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280527 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	4.1e+02	12.4	non-SMC mitotic condensation complex subunit 1
2	PF11864 DUF3384	3.8e-85	298.2	Domain of unknown function (DUF3384)
3	PF02145 Rap_GAP	1.8e-39	146.7	Rap/ran-GAP
4	PF10193 Telomere_reg-2	3.5e+02	12.9	Telomere length regulation protein
5	PF03542 Tuberin	6.5e-147	500.8	Tuberin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262187	0.999	GTP-binding protein Rheb
2	9606.ENSP00000298552	0.999	Hamartin
3	9606.ENSP00000354558	0.999	Serine/threonine-protein kinase mTOR
4	9606.ENSP00000475727	0.999	TBC1 domain family member 7
5	9606.ENSP00000379287	0.998	14-3-3 protein zeta/delta
6	9606.ENSP00000296782	0.997	Rapamycin-insensitive companion of mTOR
7	9606.ENSP00000361930	0.997	14-3-3 protein beta/alpha
8	9606.ENSP00000451828	0.996	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000307272	0.994	Regulatory-associated protein of mTOR
10	9606.ENSP00000369899	0.993	Ras-related GTP-binding protein A
11	9606.ENSP00000262850	0.991	Ras-related GTP-binding protein B
12	9606.ENSP00000306330	0.991	14-3-3 protein gamma
13	9606.ENSP00000262304	0.988	Polycystin-1
14	9606.ENSP00000362092	0.988	Ras-related GTP-binding protein C
15	9606.ENSP00000435412	0.988	Ribosomal protein S6 kinase alpha-1
16	9606.ENSP00000456405	0.988	Target of rapamycin complex subunit LST8
17	9606.ENSP00000264255	0.987	Thioredoxin domain-containing protein 9
18	9606.ENSP00000307305	0.987	DNA damage-inducible transcript 4 protein
19	9606.ENSP00000346148	0.986	5'-AMP-activated protein kinase catalytic subunit alpha-1
20	9606.ENSP00000460380	0.985	Ubiquitin carboxyl-terminal hydrolase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0019899	0.997	enzyme binding
GO:0042802	0.883	identical protein binding
GO:0051879	0.758	Hsp90 protein binding
GO:0046983	0.722	protein dimerization activity
GO:0051020	0.708	GTPase binding
GO:0031267	0.678	small GTPase binding
GO:0071889	0.659	14-3-3 protein binding
GO:0019902	0.654	phosphatase binding
GO:0042803	0.647	protein homodimerization activity
GO:0044877	0.600	protein-containing complex binding
GO:0019900	0.488	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0048519	0.985	negative regulation of biological process
GO:0050896	0.981	response to stimulus
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.972	positive regulation of cellular process
GO:0048523	0.971	negative regulation of cellular process
GO:0032501	0.960	multicellular organismal process
GO:0042325	0.946	regulation of phosphorylation
GO:0048583	0.943	regulation of response to stimulus
GO:0031399	0.943	regulation of protein modification process
GO:0051716	0.940	cellular response to stimulus
GO:0009893	0.940	positive regulation of metabolic process
GO:0050790	0.939	regulation of catalytic activity
GO:0001932	0.927	regulation of protein phosphorylation
GO:1902531	0.926	regulation of intracellular signal transduction
GO:0031325	0.908	positive regulation of cellular metabolic process
GO:0032502	0.907	developmental process
GO:0051338	0.902	regulation of transferase activity
GO:0009892	0.892	negative regulation of metabolic process
GO:0051179	0.890	localization
GO:0009894	0.890	regulation of catabolic process
GO:0043549	0.887	regulation of kinase activity
GO:0031324	0.882	negative regulation of cellular metabolic process
GO:0016241	0.882	regulation of macroautophagy
GO:0007154	0.877	cell communication
GO:0044092	0.873	negative regulation of molecular function
GO:0042127	0.871	regulation of cell population proliferation
GO:0048585	0.854	negative regulation of response to stimulus
GO:0023052	0.844	signaling
GO:0009968	0.844	negative regulation of signal transduction
GO:0032006	0.835	regulation of TOR signaling
GO:0048856	0.833	anatomical structure development
GO:0007165	0.820	signal transduction
GO:0009896	0.815	positive regulation of catabolic process
GO:0032007	0.805	negative regulation of TOR signaling
GO:0051641	0.781	cellular localization
GO:0051239	0.777	regulation of multicellular organismal process
GO:0043086	0.777	negative regulation of catalytic activity
GO:0010563	0.776	negative regulation of phosphorus metabolic process
GO:0045936	0.766	negative regulation of phosphate metabolic process
GO:0010508	0.761	positive regulation of autophagy
GO:0007275	0.756	multicellular organism development
GO:0051234	0.732	establishment of localization
GO:0051348	0.693	negative regulation of transferase activity
GO:0008152	0.688	metabolic process
GO:0042326	0.686	negative regulation of phosphorylation
GO:0033673	0.684	negative regulation of kinase activity
GO:0008285	0.683	negative regulation of cell population proliferation
GO:0071840	0.661	cellular component organization or biogenesis
GO:0051128	0.658	regulation of cellular component organization
GO:0006897	0.656	endocytosis
GO:0016043	0.654	cellular component organization
GO:0010605	0.643	negative regulation of macromolecule metabolic process
GO:0044237	0.634	cellular metabolic process
GO:0051172	0.630	negative regulation of nitrogen compound metabolic process
GO:0071704	0.540	organic substance metabolic process
GO:0051248	0.502	negative regulation of protein metabolic process
GO:0008219	0.500	cell death
GO:0051241	0.493	negative regulation of multicellular organismal process
GO:0010604	0.462	positive regulation of macromolecule metabolic process
GO:0042221	0.448	response to chemical
GO:0006950	0.445	response to stress
GO:0031400	0.439	negative regulation of protein modification process
GO:0044238	0.422	primary metabolic process
GO:0051173	0.417	positive regulation of nitrogen compound metabolic process
GO:0010468	0.392	regulation of gene expression
GO:0065008	0.372	regulation of biological quality
GO:0045859	0.369	regulation of protein kinase activity
GO:0006915	0.363	apoptotic process
GO:0033554	0.340	cellular response to stress
GO:0016239	0.328	positive regulation of macroautophagy
GO:0070887	0.326	cellular response to chemical stimulus
GO:0035556	0.325	intracellular signal transduction
GO:0044093	0.320	positive regulation of molecular function
GO:0010033	0.314	response to organic substance
GO:0051049	0.308	regulation of transport
GO:0043085	0.307	positive regulation of catalytic activity
GO:0019219	0.304	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.301	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0070013	0.529	intracellular organelle lumen
GO:0030054	0.371	cell junction
GO:0045202	0.358	synapse
GO:0043231	0.346	intracellular membrane-bounded organelle
GO:0032991	0.344	protein-containing complex
GO:0016020	0.313	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]