StarFunc result for job id P49821

User Input

>input (464 residues)
MLATRRLLGWSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRG
DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KNH5	0.964	0.964	8.024E-87	464	1.000	1.000	E5KNH5.pdb.gz	E5KNH5_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 PE=3 SV=1
2	AFDB:Q17880	0.938	0.908	8.802E-77	479	0.778	0.754	Q17880.pdb.gz	Q17880_CAEEL NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuo-1 PE=1 SV=1
3	PDB:7qskF	0.926	0.995	1.754E-76	432	0.907	0.975	7qskF.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
4	AFDB:Q9FNN5	0.947	0.904	3.235E-71	486	0.709	0.677	Q9FNN5.pdb.gz	NDUV1_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08530 PE=1 SV=1
5	AFDB:A2QJ32	0.923	0.864	3.780E-70	496	0.685	0.641	A2QJ32.pdb.gz	A2QJ32_ASPNC NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=nuo51 PE=3 SV=1
6	AFDB:Q59TD5	0.936	0.887	2.907E-69	490	0.670	0.635	Q59TD5.pdb.gz	Q59TD5_CANAL NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NDH51 PE=3 SV=1
7	AFDB:Q57VW8	0.931	0.871	1.911E-68	496	0.636	0.595	Q57VW8.pdb.gz	Q57VW8_TRYB2 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.29K2.470 PE=3 SV=1
8	PDB:7aqrF	0.917	0.980	2.487E-62	434	0.692	0.740	7aqrF.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
9	AFDB:A1Z9Z7	0.908	0.876	1.450E-56	481	0.506	0.489	A1Z9Z7.pdb.gz	A1Z9Z7_DROME NADH dehydrogenase (Ubiquinone) 51 kDa subunit-like 2, isoform A OS=Drosophila melanogaster OX=7227 GN=ND-51L2 PE=3 SV=1
10	AFDB:O94500	0.870	0.893	1.158E-43	452	0.334	0.343	O94500.pdb.gz	NDUV1_SCHPO NADH-ubiquinone oxidoreductase 51 kDa subunit homolog SPBC18E5.10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC18E5.10 PE=3 SV=1
11	AFDB:P31979	0.852	0.887	1.499E-40	445	0.371	0.387	P31979.pdb.gz	NUOF_ECOLI NADH-quinone oxidoreductase subunit F OS=Escherichia coli (strain K12) OX=83333 GN=nuoF PE=1 SV=3
12	AFDB:Q46507	0.844	0.800	5.247E-38	490	0.336	0.318	Q46507.pdb.gz	HNDC_SOLFR NADP-reducing hydrogenase subunit HndC OS=Solidesulfovibrio fructosivorans OX=878 GN=hndC PE=1 SV=1
13	PDB:7nyrF	0.830	0.872	8.925E-37	441	0.369	0.388	7nyrF.pdb.gz	Structure of Escherichia coli respiratory complex I reconstituted into lipid nanodiscs reveals an uncoupled conformation.
14	PDB:7xk3A	0.351	0.363	1.237E-3	446	0.080	0.083	7xk3A.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
15	PDB:7d8fA	0.126	0.205	3.007E-2	234	0.047	0.094	7d8fA.pdb.gz	Structural Basis for Peptide Binding of Alpha-N Terminal Methyltransferase from Saccharomyces cerevisiae
16	PDB:4ihqA	0.095	0.091	2.082E-1	512	0.093	0.084	4ihqA.pdb.gz	Insights into FlaI Functions in Archaeal Motor Assembly and Motility from Structures, Conformations, and Genetics.
17	PDB:7f66J	0.179	0.145	2.082E-1	591	0.037	0.029	7f66J.pdb.gz
18	PDB:6jlzI	0.151	0.160	2.567E-1	430	0.034	0.037	6jlzI.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
19	PDB:7csaA	0.113	0.157	2.850E-1	310	0.039	0.058	7csaA.pdb.gz	Structure-based engineering of substrate specificity for pinoresinol-lariciresinol reductases.
20	PDB:2gm3A	0.137	0.272	4.563E-1	153	0.030	0.092	2gm3A.pdb.gz	Crystal structure of the protein At3g01520, a eukaryotic universal stress protein-like protein from arabidopsis thaliana in complex with AMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2QJ32	0.0	668	496	0.672	0.629	A2QJ32_ASPNC NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=nuo51 PE=3 SV=1
2	B4DE93	0.0	752	363	0.782	1.000	B4DE93_HUMAN NADH:ubiquinone oxidoreductase core subunit V1 OS=Homo sapiens OX=9606 GN=NDUFV1 PE=1 SV=1
3	E5KNH5	0.0	957	464	1.000	1.000	E5KNH5_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 PE=3 SV=1
4	G3V0I5	0.0	936	457	0.985	1.000	G3V0I5_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1 PE=1 SV=1
5	P25708	0.0	935	464	0.972	0.972	NDUV1_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Bos taurus OX=9913 GN=NDUFV1 PE=1 SV=2
6	P49821	0.0	957	464	1.000	1.000	NDUV1_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1 PE=1 SV=4
7	Q17880	0.0	761	479	0.778	0.754	Q17880_CAEEL NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=nuo-1 PE=1 SV=1
8	Q57VW8	0.0	622	496	0.631	0.591	Q57VW8_TRYB2 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.29K2.470 PE=3 SV=1
9	Q59TD5	0.0	652	490	0.662	0.627	Q59TD5_CANAL NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NDH51 PE=3 SV=1
10	Q91YT0	0.0	920	464	0.959	0.959	NDUV1_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Mus musculus OX=10090 GN=Ndufv1 PE=1 SV=1
11	Q9FNN5	0.0	671	486	0.681	0.650	NDUV1_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g08530 PE=1 SV=1
12	A1Z9Z7	1.34e-166	480	481	0.498	0.480	A1Z9Z7_DROME NADH dehydrogenase (Ubiquinone) 51 kDa subunit-like 2, isoform A OS=Drosophila melanogaster OX=7227 GN=ND-51L2 PE=3 SV=1
13	Q8T495	9.98e-153	444	462	0.468	0.470	Q8T495_DROME AT08706p OS=Drosophila melanogaster OX=7227 GN=ND-51L2 PE=2 SV=1
14	A1Z9Z6	4.15e-152	442	462	0.468	0.470	A1Z9Z6_DROME FI21939p1 OS=Drosophila melanogaster OX=7227 GN=ND-51L2 PE=2 SV=1
15	P31979	2.72e-106	325	445	0.364	0.380	NUOF_ECOLI NADH-quinone oxidoreductase subunit F OS=Escherichia coli (strain K12) OX=83333 GN=nuoF PE=1 SV=3
16	O94500	6.14e-96	298	452	0.336	0.345	NDUV1_SCHPO NADH-ubiquinone oxidoreductase 51 kDa subunit homolog SPBC18E5.10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC18E5.10 PE=3 SV=1
17	Q46507	1.20e-84	270	490	0.325	0.308	HNDC_SOLFR NADP-reducing hydrogenase subunit HndC OS=Solidesulfovibrio fructosivorans OX=878 GN=hndC PE=1 SV=1
18	H6LC32	7.81e-05	47.4	443	0.119	0.124	RNFC_ACEWD Na(+)-translocating ferredoxin:NAD(+) oxidoreductase complex subunit C OS=Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) OX=931626 GN=rnfC PE=1 SV=1
19	Q74FU5	1.53e-04	46.6	672	0.056	0.039	SFRB_GEOSL NADPH-Fe(3+) oxidoreductase subunit beta OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=sfrB PE=1 SV=1
20	A0A0B4KEJ7	1.3	33.9	535	0.112	0.097	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01512 Complex1_51K	1.5e-46	169.5	Respiratory-chain NADH dehydrogenase 51 Kd subunit
2	PF10589 NADH_4Fe-4S	4.1e-27	105.2	NADH-ubiquinone oxidoreductase-F iron-sulfur binding region
3	PF10531 SLBB	0.0067	27.5	SLBB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322450

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
12	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
13	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
14	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
15	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
16	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
17	9606.ENSP00000327268	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
18	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
19	9606.ENSP00000346196	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
20	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0003824	0.839	catalytic activity
GO:0016491	0.708	oxidoreductase activity
GO:0003954	0.372	NADH dehydrogenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0019646	0.986	aerobic electron transport chain
GO:0042775	0.909	mitochondrial ATP synthesis coupled electron transport
GO:0006120	0.899	mitochondrial electron transport, NADH to ubiquinone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0032991	0.995	protein-containing complex
GO:0031090	0.995	organelle membrane
GO:0005743	0.987	mitochondrial inner membrane
GO:1902494	0.985	catalytic complex
GO:0005829	0.981	cytosol
GO:0098796	0.953	membrane protein complex
GO:0098798	0.945	mitochondrial protein-containing complex
GO:0098800	0.920	inner mitochondrial membrane protein complex
GO:0045271	0.911	respiratory chain complex I
GO:0005746	0.827	mitochondrial respirasome
GO:0005747	0.752	mitochondrial respiratory chain complex I
GO:0070013	0.489	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.708	Oxidoreductases.
RHEA:11356	0.372	A + H(+) + NADH = AH2 + NAD(+)

[back to server]