StarFunc result for job id P49840

User Input

>input (483 residues)
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2NL51	0.776	0.765	2.124E-74	490	0.946	0.933	Q2NL51.pdb.gz	GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus OX=10090 GN=Gsk3a PE=1 SV=2
2	AFDB:Q9YH61	0.741	0.811	4.812E-64	440	0.733	0.805	Q9YH61.pdb.gz	Q9YH61_DANRE [tau protein] kinase OS=Danio rerio OX=7955 GN=gsk3a PE=1 SV=1
3	AFDB:A0A0D9R447	0.728	0.810	3.525E-59	433	0.640	0.714	A0A0D9R447.pdb.gz	A0A0D9R447_CHLSB [tau protein] kinase OS=Chlorocebus sabaeus OX=60711 GN=GSK3B PE=3 SV=1
4	AFDB:P18431	0.722	0.679	1.475E-57	514	0.598	0.562	P18431.pdb.gz	SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster OX=7227 GN=sgg PE=1 SV=3
5	PDB:1j1bB	0.711	0.942	1.972E-57	364	0.621	0.824	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
6	AFDB:P83101	0.714	0.689	1.762E-53	501	0.501	0.483	P83101.pdb.gz	GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster OX=7227 GN=gskt PE=2 SV=1
7	AFDB:Q9U2Q9	0.674	0.899	2.559E-53	362	0.518	0.691	Q9U2Q9.pdb.gz	GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans OX=6239 GN=gsk-3 PE=1 SV=1
8	AFDB:Q8VZD5	0.702	0.825	2.341E-49	410	0.482	0.568	Q8VZD5.pdb.gz	KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana OX=3702 GN=ASK5 PE=1 SV=1
9	AFDB:Q5Z7J0	0.697	0.832	5.212E-49	403	0.476	0.571	Q5Z7J0.pdb.gz	GSK4_ORYSJ Shaggy-related protein kinase GSK4 OS=Oryza sativa subsp. japonica OX=39947 GN=GSK4 PE=1 SV=1
10	AFDB:Q39010	0.698	0.817	6.116E-49	412	0.484	0.568	Q39010.pdb.gz	KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana OX=3702 GN=ASK6 PE=1 SV=2
11	AFDB:Q96287	0.704	0.720	9.371E-49	472	0.478	0.489	Q96287.pdb.gz	KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana OX=3702 GN=ASK8 PE=2 SV=3
12	PDB:1i09A	0.666	0.949	4.508E-48	338	0.578	0.825	1i09A.pdb.gz	Structure of GSK3beta reveals a primed phosphorylation mechanism.
13	PDB:1unlA	0.524	0.848	2.941E-24	292	0.207	0.342	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
14	PDB:7opmA	0.533	0.703	5.577E-24	362	0.211	0.282	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
15	PDB:4krcA	0.532	0.843	2.355E-23	297	0.188	0.306	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:2zoqA	0.530	0.718	5.831E-23	352	0.207	0.284	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
17	PDB:7cgaA	0.528	0.722	2.889E-22	347	0.203	0.282	7cgaA.pdb.gz
18	PDB:5bvdA	0.493	0.712	4.925E-22	330	0.195	0.285	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
19	PDB:4eomC	0.485	0.835	1.039E-21	276	0.193	0.337	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:4yc3A	0.517	0.831	2.440E-21	295	0.199	0.325	4yc3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9R447	0.0	638	433	0.636	0.709	A0A0D9R447_CHLSB [tau protein] kinase OS=Chlorocebus sabaeus OX=60711 GN=GSK3B PE=3 SV=1
2	A0A3B3ITW1	0.0	620	387	0.613	0.765	A0A3B3ITW1_HUMAN [tau protein] kinase OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2
3	B2LUN4	0.0	647	420	0.642	0.738	B2LUN4_PIG [tau protein] kinase OS=Sus scrofa OX=9823 GN=GSK3-beta PE=2 SV=1
4	F1NPL8	0.0	649	399	0.636	0.769	F1NPL8_CHICK [tau protein] kinase OS=Gallus gallus OX=9031 GN=GSK3A PE=1 SV=4
5	G1T8E2	0.0	638	432	0.636	0.711	G1T8E2_RABIT [tau protein] kinase OS=Oryctolagus cuniculus OX=9986 GN=GSK3B PE=1 SV=2
6	H0ZT29	0.0	641	433	0.636	0.709	H0ZT29_TAEGU [tau protein] kinase OS=Taeniopygia guttata OX=59729 GN=GSK3B PE=3 SV=2
7	I6ZX61	0.0	649	420	0.644	0.740	I6ZX61_PIG [tau protein] kinase OS=Sus scrofa OX=9823 GN=GSK3B PE=2 SV=1
8	P18265	0.0	948	483	0.971	0.971	GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus norvegicus OX=10116 GN=Gsk3a PE=1 SV=1
9	P18266	0.0	643	420	0.627	0.721	GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus OX=10116 GN=Gsk3b PE=1 SV=1
10	P18431	0.0	598	514	0.586	0.551	SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster OX=7227 GN=sgg PE=1 SV=3
11	P49840	0.0	977	483	1.000	1.000	GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2
12	P49841	0.0	647	420	0.636	0.731	GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2
13	Q2NL51	0.0	776	490	0.921	0.908	GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus OX=10090 GN=Gsk3a PE=1 SV=2
14	Q6FI27	0.0	647	420	0.636	0.731	Q6FI27_HUMAN [tau protein] kinase OS=Homo sapiens OX=9606 GN=GSK3B PE=2 SV=1
15	Q91757	0.0	646	420	0.642	0.738	GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis OX=8355 GN=gsk3b PE=1 SV=1
16	Q9U2Q9	0.0	529	362	0.518	0.691	GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans OX=6239 GN=gsk-3 PE=1 SV=1
17	Q9WV60	0.0	643	420	0.629	0.724	GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus OX=10090 GN=Gsk3b PE=1 SV=2
18	Q9YH60	0.0	645	421	0.638	0.732	Q9YH60_DANRE [tau protein] kinase OS=Danio rerio OX=7955 GN=gsk3b PE=1 SV=1
19	Q9YH61	0.0	675	440	0.660	0.725	Q9YH61_DANRE [tau protein] kinase OS=Danio rerio OX=7955 GN=gsk3a PE=1 SV=1
20	P83101	8.05e-180	515	501	0.499	0.481	GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster OX=7227 GN=gskt PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.92	20.1	ABC1 atypical kinase-like domain
2	PF01636 APH	3.5	19.0	Phosphotransferase enzyme family
3	PF06293 Kdo	1.3e+02	13.3	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	5.3	17.9	Kinase-like
5	PF00069 Pkinase	1.7e-66	235.9	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	2.8e-22	90.8	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.999	Axin-1
2	9606.ENSP00000344456	0.997	Catenin beta-1
3	9606.ENSP00000451828	0.992	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000302625	0.971	Axin-2
5	9606.ENSP00000340820	0.967	Microtubule-associated protein tau
6	9606.ENSP00000342307	0.960	Forkhead box protein M1
7	9606.ENSP00000261349	0.959	Low-density lipoprotein receptor-related protein 6
8	9606.ENSP00000257430	0.958	Adenomatous polyposis coli protein
9	9606.ENSP00000284523	0.943	Protein Wnt-3a
10	9606.ENSP00000368169	0.942	Segment polarity protein dishevelled homolog DVL-1
11	9606.ENSP00000263826	0.937	RAC-gamma serine/threonine-protein kinase
12	9606.ENSP00000005340	0.936	Segment polarity protein dishevelled homolog DVL-2
13	9606.ENSP00000324806	0.935	Glycogen synthase kinase-3 beta
14	9606.ENSP00000375892	0.934	RAC-beta serine/threonine-protein kinase
15	9606.ENSP00000316054	0.933	Segment polarity protein dishevelled homolog DVL-3
16	9606.ENSP00000261461	0.926	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
17	9606.ENSP00000305777	0.924	Casein kinase I isoform gamma-1
18	9606.ENSP00000354607	0.918	Frizzled-5
19	9606.ENSP00000349156	0.911	E3 ubiquitin-protein ligase SIAH1
20	9606.ENSP00000216037	0.904	X-box-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005102	0.999	signaling receptor binding
GO:0019899	0.587	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0044237	0.974	cellular metabolic process
GO:0006807	0.969	nitrogen compound metabolic process
GO:0043170	0.968	macromolecule metabolic process
GO:0016310	0.964	phosphorylation
GO:0023051	0.956	regulation of signaling
GO:0010646	0.956	regulation of cell communication
GO:0019538	0.953	protein metabolic process
GO:0050896	0.943	response to stimulus
GO:0043412	0.940	macromolecule modification
GO:0006468	0.933	protein phosphorylation
GO:0019222	0.901	regulation of metabolic process
GO:0048518	0.888	positive regulation of biological process
GO:0060255	0.880	regulation of macromolecule metabolic process
GO:0080090	0.867	regulation of primary metabolic process
GO:0031323	0.864	regulation of cellular metabolic process
GO:0051716	0.859	cellular response to stimulus
GO:0048523	0.843	negative regulation of cellular process
GO:0051171	0.840	regulation of nitrogen compound metabolic process
GO:0010648	0.810	negative regulation of cell communication
GO:0032502	0.790	developmental process
GO:0048583	0.787	regulation of response to stimulus
GO:0048522	0.785	positive regulation of cellular process
GO:0048585	0.778	negative regulation of response to stimulus
GO:0023057	0.775	negative regulation of signaling
GO:0009968	0.765	negative regulation of signal transduction
GO:0009893	0.762	positive regulation of metabolic process
GO:0051128	0.760	regulation of cellular component organization
GO:0007165	0.742	signal transduction
GO:0010604	0.738	positive regulation of macromolecule metabolic process
GO:0046626	0.735	regulation of insulin receptor signaling pathway
GO:1900076	0.734	regulation of cellular response to insulin stimulus
GO:0009892	0.668	negative regulation of metabolic process
GO:1900077	0.628	negative regulation of cellular response to insulin stimulus
GO:0031325	0.615	positive regulation of cellular metabolic process
GO:0042221	0.606	response to chemical
GO:0051173	0.597	positive regulation of nitrogen compound metabolic process
GO:0010468	0.595	regulation of gene expression
GO:0009889	0.566	regulation of biosynthetic process
GO:0010556	0.543	regulation of macromolecule biosynthetic process
GO:0031326	0.542	regulation of cellular biosynthetic process
GO:0031324	0.540	negative regulation of cellular metabolic process
GO:0051246	0.505	regulation of protein metabolic process
GO:0065009	0.487	regulation of molecular function
GO:0010605	0.463	negative regulation of macromolecule metabolic process
GO:0031399	0.463	regulation of protein modification process
GO:0050793	0.461	regulation of developmental process
GO:0010941	0.459	regulation of cell death
GO:0051247	0.456	positive regulation of protein metabolic process
GO:0070887	0.451	cellular response to chemical stimulus
GO:0032501	0.449	multicellular organismal process
GO:0010033	0.445	response to organic substance
GO:0048856	0.443	anatomical structure development
GO:0051172	0.443	negative regulation of nitrogen compound metabolic process
GO:0051174	0.424	regulation of phosphorus metabolic process
GO:0019219	0.409	regulation of nucleobase-containing compound metabolic process
GO:0071310	0.403	cellular response to organic substance
GO:0071840	0.392	cellular component organization or biogenesis
GO:0019220	0.387	regulation of phosphate metabolic process
GO:0051252	0.381	regulation of RNA metabolic process
GO:0016043	0.365	cellular component organization
GO:0006355	0.362	regulation of DNA-templated transcription
GO:0007275	0.345	multicellular organism development
GO:0007166	0.341	cell surface receptor signaling pathway
GO:0051239	0.326	regulation of multicellular organismal process
GO:0031328	0.325	positive regulation of cellular biosynthetic process
GO:0050790	0.322	regulation of catalytic activity
GO:1902531	0.318	regulation of intracellular signal transduction
GO:0042325	0.315	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.999	cytosol
GO:0032991	0.993	protein-containing complex
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0070013	0.929	intracellular organelle lumen
GO:0043227	0.912	membrane-bounded organelle
GO:0043231	0.901	intracellular membrane-bounded organelle
GO:0005634	0.840	nucleus
GO:0031981	0.783	nuclear lumen
GO:0005654	0.717	nucleoplasm
GO:1902494	0.686	catalytic complex
GO:0016020	0.611	membrane
GO:0015630	0.403	microtubule cytoskeleton
GO:0140535	0.343	intracellular protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]