StarFunc result for job id P49841

User Input

>input (420 residues)
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0D9R447	0.966	0.938	2.824E-71	433	1.000	0.970	A0A0D9R447.pdb.gz	A0A0D9R447_CHLSB [tau protein] kinase OS=Chlorocebus sabaeus OX=60711 GN=GSK3B PE=3 SV=1
2	PDB:1j1bB	0.854	0.984	2.853E-61	364	0.864	0.997	1j1bB.pdb.gz	Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.
3	AFDB:Q9YH61	0.843	0.805	6.873E-61	440	0.781	0.745	Q9YH61.pdb.gz	Q9YH61_DANRE [tau protein] kinase OS=Danio rerio OX=7955 GN=gsk3a PE=1 SV=1
4	AFDB:P18431	0.897	0.736	2.778E-59	514	0.755	0.617	P18431.pdb.gz	SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster OX=7227 GN=sgg PE=1 SV=3
5	AFDB:Q2NL51	0.838	0.719	3.216E-58	490	0.750	0.643	Q2NL51.pdb.gz	GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus OX=10090 GN=Gsk3a PE=1 SV=2
6	PDB:1i09A	0.796	0.987	1.810E-52	338	0.802	0.997	1i09A.pdb.gz	Structure of GSK3beta reveals a primed phosphorylation mechanism.
7	AFDB:Q9U2Q9	0.795	0.922	3.929E-52	362	0.619	0.718	Q9U2Q9.pdb.gz	GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans OX=6239 GN=gsk-3 PE=1 SV=1
8	AFDB:P83101	0.820	0.688	1.763E-50	501	0.588	0.493	P83101.pdb.gz	GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster OX=7227 GN=gskt PE=2 SV=1
9	AFDB:Q60EZ2	0.840	0.876	7.907E-49	402	0.564	0.590	Q60EZ2.pdb.gz	GSK2_ORYSJ Shaggy-related protein kinase GSK2 OS=Oryza sativa subsp. japonica OX=39947 GN=GSK2 PE=1 SV=1
10	AFDB:Q39010	0.817	0.832	3.583E-48	412	0.567	0.578	Q39010.pdb.gz	KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana OX=3702 GN=ASK6 PE=1 SV=2
11	AFDB:Q8VZD5	0.808	0.828	3.583E-48	410	0.586	0.600	Q8VZD5.pdb.gz	KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana OX=3702 GN=ASK5 PE=1 SV=1
12	AFDB:Q9LWN0	0.816	0.841	8.688E-48	407	0.564	0.582	Q9LWN0.pdb.gz	GSK1_ORYSJ Shaggy-related protein kinase GSK1 OS=Oryza sativa subsp. japonica OX=39947 GN=GSK1 PE=1 SV=1
13	PDB:7opmA	0.612	0.706	2.053E-23	362	0.262	0.304	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
14	PDB:1unlA	0.602	0.853	4.258E-23	292	0.233	0.336	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4krcA	0.602	0.836	3.605E-22	297	0.221	0.313	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:7cgaA	0.593	0.711	4.928E-22	347	0.236	0.285	7cgaA.pdb.gz
17	PDB:2zoqA	0.618	0.731	5.470E-22	352	0.257	0.307	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
18	PDB:4eomC	0.560	0.840	3.388E-21	276	0.224	0.341	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:5bvdA	0.577	0.727	3.388E-21	330	0.243	0.309	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
20	PDB:2b9iA	0.576	0.709	1.183E-20	338	0.250	0.311	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0D9R447	864	433	1.000	0.970	A0A0D9R447_CHLSB [tau protein] kinase OS=Chlorocebus sabaeus OX=60711 GN=GSK3B PE=3 SV=1
2	A0A3B3ITW1	791	387	0.921	1.000	A0A3B3ITW1_HUMAN [tau protein] kinase OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2
3	B2LUN4	864	420	0.986	0.986	B2LUN4_PIG [tau protein] kinase OS=Sus scrofa OX=9823 GN=GSK3-beta PE=2 SV=1
4	F1NPL8	787	399	0.905	0.952	F1NPL8_CHICK [tau protein] kinase OS=Gallus gallus OX=9031 GN=GSK3A PE=1 SV=4
5	G1T8E2	822	432	0.950	0.924	G1T8E2_RABIT [tau protein] kinase OS=Oryctolagus cuniculus OX=9986 GN=GSK3B PE=1 SV=2
6	H0ZT29	839	433	0.969	0.940	H0ZT29_TAEGU [tau protein] kinase OS=Taeniopygia guttata OX=59729 GN=GSK3B PE=3 SV=2
7	I6ZX61	867	420	0.990	0.990	I6ZX61_PIG [tau protein] kinase OS=Sus scrofa OX=9823 GN=GSK3B PE=2 SV=1
8	P18265	648	483	0.743	0.646	GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus norvegicus OX=10116 GN=Gsk3a PE=1 SV=1
9	P18266	863	420	0.988	0.988	GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus OX=10116 GN=Gsk3b PE=1 SV=1
10	P18431	639	514	0.729	0.595	SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster OX=7227 GN=sgg PE=1 SV=3
11	P49840	647	483	0.743	0.646	GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2
12	P49841	873	420	1.000	1.000	GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2
13	P83101	533	501	0.588	0.493	GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster OX=7227 GN=gskt PE=2 SV=1
14	Q2NL51	645	490	0.743	0.637	GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus OX=10090 GN=Gsk3a PE=1 SV=2
15	Q6FI27	873	420	1.000	1.000	Q6FI27_HUMAN [tau protein] kinase OS=Homo sapiens OX=9606 GN=GSK3B PE=2 SV=1
16	Q8VZD5	516	410	0.595	0.610	KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana OX=3702 GN=ASK5 PE=1 SV=1
17	Q91757	783	420	0.907	0.907	GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis OX=8355 GN=gsk3b PE=1 SV=1
18	Q9U2Q9	543	362	0.607	0.704	GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans OX=6239 GN=gsk-3 PE=1 SV=1
19	Q9WV60	865	420	0.990	0.990	GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus OX=10090 GN=Gsk3b PE=1 SV=2
20	Q9YH60	813	421	0.924	0.922	Q9YH60_DANRE [tau protein] kinase OS=Danio rerio OX=7955 GN=gsk3b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.57	20.8	ABC1 atypical kinase-like domain
2	PF01636 APH	17	16.8	Phosphotransferase enzyme family
3	PF06293 Kdo	63	14.4	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	1.9	19.4	Kinase-like
5	PF00069 Pkinase	5.6e-65	230.9	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	2.3e-20	84.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000008296

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000011461	0.999	Catenin beta 1
2	9668.ENSMPUP00000015918	0.999	Axin 1
3	9668.ENSMPUP00000008060	0.997	Microtubule-associated protein tau
4	9668.ENSMPUP00000012597	0.997	APC, WNT signaling pathway regulator
5	9668.ENSMPUP00000014547	0.996	Axin 2
6	9668.ENSMPUP00000003675	0.990	Presenilin
7	9668.ENSMPUP00000001316	0.986	Uncharacterized protein
8	9668.ENSMPUP00000008945	0.981	Cellular tumor antigen p53
9	9668.ENSMPUP00000015049	0.979	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
10	9668.ENSMPUP00000008129	0.976	APC2, WNT signaling pathway regulator
11	9668.ENSMPUP00000016941	0.976	FRAT2, WNT signaling pathway regulator
12	9668.ENSMPUP00000017599	0.974	V-akt murine thymoma viral oncogene homolog 2
13	9668.ENSMPUP00000016819	0.972	Beta-transducin repeat containing E3 ubiquitin protein ligase
14	9668.ENSMPUP00000003259	0.971	Glycogen [starch] synthase
15	9668.ENSMPUP00000002136	0.968	V-akt murine thymoma viral oncogene homolog 1
16	9668.ENSMPUP00000015621	0.967	V-akt murine thymoma viral oncogene homolog 3
17	9668.ENSMPUP00000004532	0.964	Cyclin D1
18	9668.ENSMPUP00000007716	0.960	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
19	9668.ENSMPUP00000017446	0.960	Snail family zinc finger 1
20	9668.ENSMPUP00000010405	0.955	Dishevelled segment polarity protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0050794	0.988	regulation of cellular process
GO:0048856	0.986	anatomical structure development
GO:0009987	0.984	cellular process
GO:0007275	0.966	multicellular organism development
GO:0019222	0.954	regulation of metabolic process
GO:0050896	0.937	response to stimulus
GO:0048518	0.936	positive regulation of biological process
GO:0048731	0.935	system development
GO:0048519	0.916	negative regulation of biological process
GO:0060255	0.916	regulation of macromolecule metabolic process
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0048523	0.887	negative regulation of cellular process
GO:0080090	0.885	regulation of primary metabolic process
GO:0031323	0.871	regulation of cellular metabolic process
GO:0048522	0.828	positive regulation of cellular process
GO:0048583	0.804	regulation of response to stimulus
GO:0010646	0.804	regulation of cell communication
GO:0023051	0.803	regulation of signaling
GO:0051246	0.797	regulation of protein metabolic process
GO:0048513	0.782	animal organ development
GO:0009966	0.771	regulation of signal transduction
GO:0009653	0.735	anatomical structure morphogenesis
GO:0051716	0.734	cellular response to stimulus
GO:0071704	0.720	organic substance metabolic process
GO:0044238	0.718	primary metabolic process
GO:0044237	0.714	cellular metabolic process
GO:0009888	0.700	tissue development
GO:0006807	0.694	nitrogen compound metabolic process
GO:0065009	0.679	regulation of molecular function
GO:0072359	0.667	circulatory system development
GO:0060429	0.663	epithelium development
GO:0009887	0.649	animal organ morphogenesis
GO:0035239	0.649	tube morphogenesis
GO:0009790	0.644	embryo development
GO:0007507	0.643	heart development
GO:0043170	0.640	macromolecule metabolic process
GO:0010604	0.636	positive regulation of macromolecule metabolic process
GO:0060972	0.632	left/right pattern formation
GO:0051173	0.632	positive regulation of nitrogen compound metabolic process
GO:0031325	0.630	positive regulation of cellular metabolic process
GO:0035050	0.615	embryonic heart tube development
GO:0001947	0.607	heart looping
GO:0042221	0.574	response to chemical
GO:0009889	0.563	regulation of biosynthetic process
GO:0019538	0.539	protein metabolic process
GO:0010468	0.525	regulation of gene expression
GO:0031326	0.490	regulation of cellular biosynthetic process
GO:0030154	0.488	cell differentiation
GO:0023052	0.480	signaling
GO:0051239	0.458	regulation of multicellular organismal process
GO:0050793	0.448	regulation of developmental process
GO:0010033	0.448	response to organic substance
GO:0007165	0.446	signal transduction
GO:0070887	0.391	cellular response to chemical stimulus
GO:0071840	0.359	cellular component organization or biogenesis
GO:0051174	0.356	regulation of phosphorus metabolic process
GO:0010556	0.335	regulation of macromolecule biosynthetic process
GO:0006950	0.332	response to stress
GO:0048585	0.331	negative regulation of response to stimulus
GO:0016310	0.329	phosphorylation
GO:0009968	0.324	negative regulation of signal transduction
GO:0006468	0.324	protein phosphorylation
GO:0019219	0.323	regulation of nucleobase-containing compound metabolic process
GO:0042325	0.320	regulation of phosphorylation
GO:0016043	0.316	cellular component organization
GO:0006355	0.314	regulation of DNA-templated transcription
GO:0009719	0.308	response to endogenous stimulus
GO:1901700	0.306	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.978	intracellular organelle lumen
GO:0005737	0.946	cytoplasm
GO:0005829	0.938	cytosol
GO:0031981	0.934	nuclear lumen
GO:0032991	0.927	protein-containing complex
GO:0005654	0.906	nucleoplasm
GO:0030054	0.507	cell junction
GO:0045202	0.427	synapse
GO:0043232	0.340	intracellular non-membrane-bounded organelle
GO:0016020	0.305	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]