StarFunc result for job id P49842

User Input

>input (368 residues)
MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPI
RGRRGARPGGGDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIP
ETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVP
DRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVCDCVLKACDGRPYAGAVQ
KFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIK
YFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDCISTTSG
TLLRLPET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49842	1.000	1.000	1.372E-61	368	1.000	1.000	P49842.pdb.gz	STK19_HUMAN Inactive serine/threonine-protein kinase 19 OS=Homo sapiens OX=9606 GN=STK19 PE=2 SV=3
2	PDB:5afqB	0.168	0.147	3.788E-3	444	0.087	0.072	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
3	PDB:2fxaB	0.139	0.257	3.304E-2	180	0.065	0.133	2fxaB.pdb.gz
4	PDB:3cuqA	0.167	0.239	3.903E-2	219	0.049	0.082	3cuqA.pdb.gz
5	PDB:2xv4S	0.190	0.178	4.362E-2	399	0.084	0.078	2xv4S.pdb.gz
6	PDB:5lzbz	0.153	0.104	5.153E-2	614	0.052	0.031	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
7	PDB:7d58O	0.169	0.138	5.758E-2	490	0.098	0.073	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
8	PDB:7z1mO	0.171	0.121	6.087E-2	570	0.084	0.054	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
9	PDB:7a6hO	0.179	0.136	7.601E-2	512	0.073	0.053	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
10	PDB:3cuqC	0.160	0.299	8.494E-2	173	0.060	0.127	3cuqC.pdb.gz
11	PDB:7dn3O	0.181	0.160	1.121E-1	443	0.068	0.056	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
12	AFDB:Q9P789	0.093	0.041	1.292	1065	0.117	0.040	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
13	AFDB:P98174	0.113	0.056	1.706	961	0.147	0.056	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
14	AFDB:Q9Y0I1	0.105	0.096	1.906	424	0.114	0.099	Q9Y0I1.pdb.gz	EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster OX=7227 GN=MRG15 PE=1 SV=1
15	AFDB:Q389I6	0.081	0.049	2.130	742	0.103	0.051	Q389I6.pdb.gz	Q389I6_TRYB2 IQ calmodulin-binding motif containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0360 PE=4 SV=1
16	AFDB:A0A499FIZ0	0.105	0.066	2.252	761	0.125	0.060	A0A499FIZ0.pdb.gz	A0A499FIZ0_HUMAN WD repeat domain 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=2
17	AFDB:P56931	0.131	0.114	3.143	443	0.114	0.095	P56931.pdb.gz	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
18	AFDB:Q0WQK1	0.111	0.057	3.143	961	0.109	0.042	Q0WQK1.pdb.gz	Q0WQK1_ARATH Uncharacterized protein At1g27595 OS=Arabidopsis thaliana OX=3702 GN=At1g27595 PE=2 SV=1
19	AFDB:B6EUA9	0.139	0.065	3.512	958	0.095	0.037	B6EUA9.pdb.gz	PR40A_ARATH Pre-mRNA-processing protein 40A OS=Arabidopsis thaliana OX=3702 GN=PRP40A PE=1 SV=1
20	AFDB:Q27368	0.098	0.059	3.512	805	0.098	0.045	Q27368.pdb.gz	E2F1_DROME Transcription factor E2f1 OS=Drosophila melanogaster OX=7227 GN=E2f1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZLI8	0.0	584	321	0.791	0.907	B7ZLI8_HUMAN Serine/threonine kinase 19 OS=Homo sapiens OX=9606 GN=STK19 PE=1 SV=1
2	P49842	0.0	749	368	1.000	1.000	STK19_HUMAN Inactive serine/threonine-protein kinase 19 OS=Homo sapiens OX=9606 GN=STK19 PE=2 SV=3
3	Q38B20	3.0	31.6	201	0.035	0.065	Q38B20_TRYB2 Translation elongation factor 1-beta, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1100 PE=3 SV=1
4	Q32PH0	3.8	32.3	1138	0.057	0.018	TPPC9_BOVIN Trafficking protein particle complex subunit 9 OS=Bos taurus OX=9913 GN=TRAPPC9 PE=1 SV=1
5	Q2L6J1	6.4	31.2	425	0.046	0.040	Q2L6J1_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=1
6	Q9BZY9	6.4	31.2	425	0.046	0.040	TRI31_HUMAN E3 ubiquitin-protein ligase TRIM31 OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=2
7	E9PU02	9.0	30.8	1139	0.054	0.018	E9PU02_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=4
8	A0A8I6AL85	9.8	30.8	873	0.054	0.023	A0A8I6AL85_RAT Trafficking protein particle complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Trappc9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10494 Stk19	3.7e-31	120.2	Serine-threonine protein kinase 19

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364543	0.792	Helicase SKI2W
2	9606.ENSP00000364578	0.776	Negative elongation factor E
3	9606.ENSP00000407685	0.722	Tenascin-X
4	9606.ENSP00000312368	0.710	Sorting nexin-31
5	9606.ENSP00000364498	0.697	Decapping and exoribonuclease protein
6	9606.ENSP00000408860	0.697	Steroid 21-hydroxylase
7	9606.ENSP00000396688	0.683	Complement C4-A
8	9606.ENSP00000354608	0.680	Lysosomal thioesterase PPT2
9	9606.ENSP00000392147	0.670	Protein phosphatase 6 catalytic subunit
10	9606.ENSP00000321703	0.653	Transforming acidic coiled-coil-containing protein 1
11	9606.ENSP00000415941	0.617	Complement C4-B
12	9606.ENSP00000393963	0.574	Kinesin-like protein KIFC1
13	9606.ENSP00000349732	0.561	Uncharacterized protein C3orf18
14	9606.ENSP00000271452	0.554	Kinetochore protein Nuf2
15	9606.ENSP00000361092	0.551	Surfeit locus protein 6
16	9606.ENSP00000331479	0.542	Cytochrome b5 domain containing 1
17	9606.ENSP00000266069	0.539	Glucose-induced degradation protein 8 homolog
18	9606.ENSP00000299367	0.539	Complement C2
19	9606.ENSP00000335044	0.513	AT-rich interactive domain-containing protein 2
20	9606.ENSP00000351989	0.512	Surfactant-associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	0.997	small GTPase binding
GO:0004674	0.997	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0044238	0.986	primary metabolic process
GO:0009987	0.984	cellular process
GO:0050789	0.983	regulation of biological process
GO:0071704	0.979	organic substance metabolic process
GO:0050794	0.957	regulation of cellular process
GO:0048583	0.956	regulation of response to stimulus
GO:0044237	0.935	cellular metabolic process
GO:0006807	0.928	nitrogen compound metabolic process
GO:0048518	0.927	positive regulation of biological process
GO:0048522	0.923	positive regulation of cellular process
GO:0043170	0.912	macromolecule metabolic process
GO:0048584	0.875	positive regulation of response to stimulus
GO:0043412	0.781	macromolecule modification
GO:1901564	0.777	organonitrogen compound metabolic process
GO:0019538	0.774	protein metabolic process
GO:0051056	0.707	regulation of small GTPase mediated signal transduction
GO:0046578	0.687	regulation of Ras protein signal transduction
GO:0051057	0.687	positive regulation of small GTPase mediated signal transduction
GO:0046579	0.681	positive regulation of Ras protein signal transduction
GO:0006468	0.647	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.997	nuclear speck
GO:0005737	0.386	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.997	Phosphotransferases with an alcohol group as acceptor.

[back to server]