StarFunc result for job id P49848

User Input

>input (677 residues)
MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHM
GKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINT
PLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKG
KGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKY
VHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFT
KSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGA
DHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIV
MSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGP
GSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGT
PKANGSQPNSGSPQPAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KR72	0.697	0.644	1.689E-74	734	1.000	0.922	J3KR72.pdb.gz	J3KR72_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1
2	AFDB:P49847	0.617	0.687	3.854E-40	606	0.402	0.449	P49847.pdb.gz	TAF6_DROME Transcription initiation factor TFIID subunit 6 OS=Drosophila melanogaster OX=7227 GN=Taf6 PE=1 SV=2
3	PDB:7egdF	0.368	0.594	1.897E-38	412	0.607	0.998	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	PDB:6mzcI	0.368	0.722	3.228E-28	339	0.486	0.971	6mzcI.pdb.gz
5	AFDB:C9JFL8	0.254	0.644	1.358E-21	232	0.343	1.000	C9JFL8.pdb.gz	C9JFL8_HUMAN TATA-box binding protein associated factor 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=9
6	PDB:6t9iE	0.476	0.724	1.780E-17	433	0.198	0.309	6t9iE.pdb.gz
7	PDB:7ktsF	0.391	0.675	1.805E-9	351	0.093	0.179	7ktsF.pdb.gz
8	AFDB:Q9S9P0	0.184	0.138	2.443E-3	990	0.081	0.056	Q9S9P0.pdb.gz	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
9	AFDB:O60610	0.155	0.092	2.771E-3	1272	0.167	0.089	O60610.pdb.gz	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
10	AFDB:Q9VS24	0.133	0.099	3.565E-3	994	0.137	0.094	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
11	AFDB:Q55BD8	0.173	0.139	4.044E-3	899	0.117	0.088	Q55BD8.pdb.gz	Q55BD8_DICDI CLIP-associating protein OS=Dictyostelium discoideum OX=44689 GN=clasp PE=4 SV=1
12	AFDB:E9PW37	0.100	0.061	1.367E-2	1286	0.130	0.068	E9PW37.pdb.gz	E9PW37_MOUSE RAS protein activator like 2 OS=Mus musculus OX=10090 GN=Rasal2 PE=1 SV=1
13	AFDB:D3ZAX5	0.084	0.067	1.834E-2	935	0.127	0.092	D3ZAX5.pdb.gz	D3ZAX5_RAT Calcium homeostasis endoplasmic reticulum protein OS=Rattus norvegicus OX=10116 GN=Cherp PE=1 SV=3
14	AFDB:Q6ZU65	0.094	0.060	2.262E-2	1347	0.183	0.092	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
15	PDB:1kx5B	0.104	0.601	6.679E-2	102	0.034	0.225	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
16	PDB:6x9oA	0.203	0.067	7.576E-2	2425	0.058	0.016	6x9oA.pdb.gz
17	PDB:2xwuB	0.216	0.169	8.239E-2	910	0.065	0.048	2xwuB.pdb.gz
18	PDB:7unkA	0.192	0.136	8.961E-2	1047	0.059	0.038	7unkA.pdb.gz
19	PDB:5tbkA	0.169	0.238	9.746E-2	417	0.037	0.060	5tbkA.pdb.gz
20	PDB:7cm7A	0.164	0.175	1.105E-1	620	0.052	0.056	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JFL8	0.0	1173	619	0.885	0.968	C9JFL8_HUMAN TATA-box binding protein associated factor 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=9
2	C9JTY6	0.0	994	611	0.749	0.830	C9JTY6_HUMAN TATA-box binding protein associated factor 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=2
3	J3KR72	0.0	1370	734	1.000	0.922	J3KR72_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1
4	P49847	0.0	546	606	0.397	0.444	TAF6_DROME Transcription initiation factor TFIID subunit 6 OS=Drosophila melanogaster OX=7227 GN=Taf6 PE=1 SV=2
5	P49848	0.0	1373	677	1.000	1.000	TAF6_HUMAN Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1
6	Q62311	0.0	1338	678	0.976	0.975	TAF6_MOUSE Transcription initiation factor TFIID subunit 6 OS=Mus musculus OX=10090 GN=Taf6 PE=1 SV=1
7	Q9MAU3	8.56e-89	289	549	0.236	0.291	TAF6_ARATH Transcription initiation factor TFIID subunit 6 OS=Arabidopsis thaliana OX=3702 GN=TAF6 PE=1 SV=1
8	O74462	1.22e-85	278	452	0.225	0.336	TAF6_SCHPO Transcription initiation factor TFIID subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf6 PE=1 SV=1
9	Q5ATZ8	4.87e-65	223	445	0.227	0.346	Q5ATZ8_EMENI Transcription initiation factor TFIID complex 60 kDa subunit (AFU_orthologue AFUA_5G03680) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08232 PE=3 SV=1
10	P53040	1.43e-59	210	516	0.195	0.256	TAF6_YEAST Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF6 PE=1 SV=1
11	F4HVA6	6.16e-58	206	527	0.176	0.226	TAF6B_ARATH Transcription initiation factor TFIID subunit 6b OS=Arabidopsis thaliana OX=3702 GN=TAF6B PE=1 SV=1
12	Q8IG94	3.24e-57	205	566	0.154	0.184	Q8IG94_DROME SD16013p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mia PE=2 SV=1
13	Q9VND0	7.31e-57	205	589	0.154	0.177	Q9VND0_DROME Meiosis I arrest, isoform A OS=Drosophila melanogaster OX=7227 GN=mia PE=4 SV=3
14	Q5UEC4	3.47e-56	203	593	0.154	0.175	Q5UEC4_DROME TAF6-like protein OS=Drosophila melanogaster OX=7227 GN=mia PE=2 SV=1
15	Q8R2K4	1.24e-37	150	616	0.160	0.175	TAF6L_MOUSE TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Mus musculus OX=10090 GN=Taf6l PE=1 SV=1
16	Q9Y6J9	8.41e-37	148	622	0.161	0.175	TAF6L_HUMAN TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1
17	Q95T18	1.38e-23	102	260	0.071	0.185	Q95T18_DROME LD25013p OS=Drosophila melanogaster OX=7227 GN=mia PE=2 SV=1
18	Q94269	0.007	42.4	2314	0.055	0.016	Q94269_CAEEL Carboxypeptidase OS=Caenorhabditis elegans OX=6239 GN=ctsa-2 PE=1 SV=2
19	Q2M2H8	0.23	37.4	2515	0.035	0.010	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
20	Q8K1G6	3.1	33.9	4782	0.059	0.008	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	37	15.7	Bromodomain associated
2	PF00125 Histone	1.4e+02	14.2	Core histone H2A/H2B/H3/H4
3	PF08769 Spo0A_C	8.9e+02	11.4	Sporulation initiation factor Spo0A C terminal
4	PF02969 TAF	1.4e-27	107.0	TATA box binding protein associated factor (TAF)
5	PF07571 TAF6_C	5.7e-27	105.1	TAF6 C-terminal HEAT repeat domain
6	PF02269 TFIID-18kDa	66	15.0	Transcription initiation factor IID, 18kD subunit
7	PF02291 TFIID-31kDa	6.6	18.2	Transcription initiation factor IID, 31kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399982

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000339917	0.999	Transcription initiation factor TFIID subunit 9B
6	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
7	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
8	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
9	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
10	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
11	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
12	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
13	9606.ENSP00000375942	0.999	TATA-box-binding protein
14	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
15	9606.ENSP00000352925	0.998	Transformation/transcription domain-associated protein
16	9606.ENSP00000418379	0.998	Transcription initiation factor TFIID subunit 1-like
17	9606.ENSP00000360515	0.997	Transcription initiation protein SPT3 homolog
18	9606.ENSP00000417510	0.996	SPT20 homolog, SAGA complex component
19	9606.ENSP00000258281	0.995	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
20	9606.ENSP00000307684	0.994	Transcriptional adapter 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0016251	0.999	RNA polymerase II general transcription initiation factor activity
GO:0008134	0.978	transcription factor binding
GO:0140297	0.961	DNA-binding transcription factor binding
GO:0060090	0.958	molecular adaptor activity
GO:0061629	0.952	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0005102	0.780	signaling receptor binding
GO:0140110	0.671	transcription regulator activity
GO:0003712	0.353	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0009987	0.981	cellular process
GO:0080090	0.979	regulation of primary metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0016573	0.976	histone acetylation
GO:0016578	0.970	histone deubiquitination
GO:2000144	0.968	positive regulation of DNA-templated transcription initiation
GO:0070897	0.968	transcription preinitiation complex assembly
GO:0006366	0.958	transcription by RNA polymerase II
GO:0009299	0.946	mRNA transcription
GO:0060261	0.945	positive regulation of transcription initiation by RNA polymerase II
GO:0051123	0.938	RNA polymerase II preinitiation complex assembly
GO:0043966	0.934	histone H3 acetylation
GO:0051726	0.928	regulation of cell cycle
GO:0042789	0.926	mRNA transcription by RNA polymerase II
GO:0016310	0.916	phosphorylation
GO:0023051	0.870	regulation of signaling
GO:0010646	0.867	regulation of cell communication
GO:2001233	0.861	regulation of apoptotic signaling pathway
GO:0048519	0.679	negative regulation of biological process
GO:2001242	0.667	regulation of intrinsic apoptotic signaling pathway
GO:2001235	0.604	positive regulation of apoptotic signaling pathway
GO:0048523	0.602	negative regulation of cellular process
GO:0006468	0.579	protein phosphorylation
GO:2001244	0.397	positive regulation of intrinsic apoptotic signaling pathway
GO:0035522	0.315	monoubiquitinated histone H2A deubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0032991	0.953	protein-containing complex
GO:1902494	0.883	catalytic complex
GO:0043232	0.875	intracellular non-membrane-bounded organelle
GO:1990234	0.826	transferase complex
GO:0140513	0.804	nuclear protein-containing complex
GO:0061695	0.742	transferase complex, transferring phosphorus-containing groups
GO:0016591	0.726	RNA polymerase II, holoenzyme
GO:0005667	0.719	transcription regulator complex
GO:0000785	0.692	chromatin
GO:0090575	0.509	RNA polymerase II transcription regulator complex
GO:0000123	0.456	histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]