StarFunc result for job id P49862

User Input

>input (253 residues)
MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49862	1.000	1.000	6.763E-52	253	1.000	1.000	P49862.pdb.gz	KLK7_HUMAN Kallikrein-7 OS=Homo sapiens OX=9606 GN=KLK7 PE=1 SV=1
2	PDB:2qxgA	0.881	0.994	2.992E-44	224	0.885	1.000	2qxgA.pdb.gz	Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7.
3	AFDB:Q91VE3	0.910	0.925	1.191E-43	249	0.727	0.739	Q91VE3.pdb.gz	KLK7_MOUSE Kallikrein-7 OS=Mus musculus OX=10090 GN=Klk7 PE=1 SV=1
4	PDB:6ahsA	0.875	0.987	1.406E-38	224	0.672	0.759	6ahsA.pdb.gz	Discovery and structure-activity relationship of imidazolinylindole derivatives as kallikrein 7 inhibitors.
5	AFDB:Q61955	0.861	0.839	7.075E-31	260	0.458	0.446	Q61955.pdb.gz	KLK8_MOUSE Kallikrein-8 OS=Mus musculus OX=10090 GN=Klk8 PE=1 SV=1
6	AFDB:Q9Y5K2	0.849	0.846	9.855E-30	254	0.443	0.441	Q9Y5K2.pdb.gz	KLK4_HUMAN Kallikrein-4 OS=Homo sapiens OX=9606 GN=KLK4 PE=1 SV=2
7	AFDB:Q8CGR6	0.865	0.795	1.297E-29	276	0.439	0.402	Q8CGR6.pdb.gz	Q8CGR6_MOUSE Glandular kallikrein KLK13 OS=Mus musculus OX=10090 GN=Klk13 PE=1 SV=1
8	AFDB:P15949	0.865	0.840	1.802E-29	261	0.455	0.441	P15949.pdb.gz	K1KB9_MOUSE Kallikrein 1-related peptidase b9 OS=Mus musculus OX=10090 GN=Klk1b9 PE=2 SV=1
9	AFDB:Q9UKR0	0.847	0.864	2.796E-29	248	0.443	0.452	Q9UKR0.pdb.gz	KLK12_HUMAN Kallikrein-12 OS=Homo sapiens OX=9606 GN=KLK12 PE=1 SV=1
10	AFDB:O60259	0.912	0.888	3.120E-29	260	0.451	0.438	O60259.pdb.gz	KLK8_HUMAN Kallikrein-8 OS=Homo sapiens OX=9606 GN=KLK8 PE=1 SV=1
11	AFDB:Q9P0G3	0.877	0.832	3.120E-29	267	0.403	0.382	Q9P0G3.pdb.gz	KLK14_HUMAN Kallikrein-14 OS=Homo sapiens OX=9606 GN=KLK14 PE=1 SV=2
12	AFDB:Q6IE12	0.860	0.850	4.336E-29	256	0.435	0.430	Q6IE12.pdb.gz	Q6IE12_RAT Kallikrein 4 OS=Rattus norvegicus OX=10116 GN=Klk4 PE=2 SV=1
13	PDB:5ms3A	0.844	0.934	5.349E-29	228	0.419	0.465	5ms3A.pdb.gz	Specificity profiles and antagonistic Ca2+ and Zn2+ regulation of human KLK8/neuropsin activity by modules identified in crystal structures
14	PDB:1npmA	0.833	0.943	3.651E-28	223	0.411	0.466	1npmA.pdb.gz
15	PDB:2ra3A	0.855	0.963	2.632E-27	224	0.368	0.415	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
16	PDB:6nvbB	0.833	0.938	9.300E-27	224	0.415	0.469	6nvbB.pdb.gz
17	PDB:2a31A	0.847	0.959	1.096E-26	223	0.383	0.435	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
18	PDB:4nffA	0.856	0.944	1.797E-26	229	0.391	0.432	4nffA.pdb.gz	Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
19	PDB:1tgsZ	0.838	0.939	2.497E-26	225	0.395	0.444	1tgsZ.pdb.gz	Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
20	PDB:1ao5A	0.842	0.901	8.822E-26	236	0.395	0.424	1ao5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49862	0.0	524	253	1.000	1.000	KLK7_HUMAN Kallikrein-7 OS=Homo sapiens OX=9606 GN=KLK7 PE=1 SV=1
2	Q91VE3	9.01e-140	394	249	0.731	0.743	KLK7_MOUSE Kallikrein-7 OS=Mus musculus OX=10090 GN=Klk7 PE=1 SV=1
3	Q61955	1.20e-75	232	260	0.451	0.438	KLK8_MOUSE Kallikrein-8 OS=Mus musculus OX=10090 GN=Klk8 PE=1 SV=1
4	Q9Y337	6.62e-75	231	293	0.451	0.389	KLK5_HUMAN Kallikrein-5 OS=Homo sapiens OX=9606 GN=KLK5 PE=1 SV=3
5	Q8CGR6	9.79e-73	225	276	0.443	0.406	Q8CGR6_MOUSE Glandular kallikrein KLK13 OS=Mus musculus OX=10090 GN=Klk13 PE=1 SV=1
6	Q9P0G3	1.12e-71	222	267	0.435	0.412	KLK14_HUMAN Kallikrein-14 OS=Homo sapiens OX=9606 GN=KLK14 PE=1 SV=2
7	P15949	1.66e-71	221	261	0.455	0.441	K1KB9_MOUSE Kallikrein 1-related peptidase b9 OS=Mus musculus OX=10090 GN=Klk1b9 PE=2 SV=1
8	Q9D140	5.64e-71	221	293	0.427	0.369	Q9D140_MOUSE Kallikrein c OS=Mus musculus OX=10090 GN=Klk5 PE=1 SV=1
9	O60259	2.68e-70	218	260	0.462	0.450	KLK8_HUMAN Kallikrein-8 OS=Homo sapiens OX=9606 GN=KLK8 PE=1 SV=1
10	P00762	1.48e-68	213	246	0.439	0.451	TRY1_RAT Serine protease 1 OS=Rattus norvegicus OX=10116 GN=Prss1 PE=1 SV=1
11	Q9QYN3	2.15e-68	214	276	0.423	0.388	KLK11_MOUSE Kallikrein-11 OS=Mus musculus OX=10090 GN=Klk11 PE=2 SV=1
12	Q9UKR3	5.40e-68	213	277	0.458	0.419	KLK13_HUMAN Kallikrein-13 OS=Homo sapiens OX=9606 GN=KLK13 PE=2 SV=1
13	O43240	2.91e-67	211	276	0.427	0.391	KLK10_HUMAN Kallikrein-10 OS=Homo sapiens OX=9606 GN=KLK10 PE=1 SV=3
14	G3V8H1	3.89e-67	210	261	0.435	0.421	G3V8H1_RAT Kallikrein 1 OS=Rattus norvegicus OX=10116 GN=Klk1 PE=4 SV=1
15	P00755	5.88e-67	210	261	0.431	0.418	K1KB1_MOUSE Kallikrein 1-related peptidase b1 OS=Mus musculus OX=10090 GN=Klk1b1 PE=2 SV=1
16	Q9UBX7	1.15e-66	209	282	0.395	0.355	KLK11_HUMAN Kallikrein-11 OS=Homo sapiens OX=9606 GN=KLK11 PE=1 SV=2
17	Q61759	2.14e-66	208	261	0.431	0.418	K1B21_MOUSE Kallikrein 1-related peptidase b21 OS=Mus musculus OX=10090 GN=Klk1b21 PE=2 SV=3
18	P00760	2.48e-66	207	246	0.411	0.423	TRY1_BOVIN Serine protease 1 OS=Bos taurus OX=9913 GN=PRSS1 PE=1 SV=3
19	Q9CPN9	5.12e-66	207	247	0.423	0.433	Q9CPN9_MOUSE RIKEN cDNA 2210010C04 gene OS=Mus musculus OX=10090 GN=Prss3b PE=1 SV=1
20	P00763	1.32e-65	206	246	0.391	0.402	TRY2_RAT Anionic trypsin-2 OS=Rattus norvegicus OX=10116 GN=Prss2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	1.8	20.3	Domain of unknown function (DUF1986)
2	PF00089 Trypsin	3.6e-65	231.4	Trypsin
3	PF13365 Trypsin_2	0.17	24.3	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375683

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.929	Cadherin-1
2	9606.ENSP00000365465	0.809	Corneodesmosin
3	9606.ENSP00000299698	0.792	Alpha-2-macroglobulin-like protein 1
4	9606.ENSP00000352936	0.774	Serine protease inhibitor Kazal-type 5
5	9606.ENSP00000337733	0.694	Kallikrein-5
6	9606.ENSP00000257192	0.667	Desmoglein-1
7	9606.ENSP00000357789	0.653	Filaggrin
8	9606.ENSP00000306461	0.651	Cornifin-B
9	9606.ENSP00000309653	0.644	Zinc finger protein GLIS1
10	9606.ENSP00000301659	0.638	Gasdermin-A
11	9606.ENSP00000257198	0.636	Desmocollin-1
12	9606.ENSP00000265023	0.615	Kininogen-1
13	9606.ENSP00000375682	0.597	Kallikrein-8
14	9606.ENSP00000367139	0.567	Serine protease inhibitor Kazal-type 9
15	9606.ENSP00000342109	0.543	Serpin A12
16	9606.ENSP00000340937	0.519	Collagen alpha-1(XVII) chain
17	9606.ENSP00000357753	0.518	Involucrin
18	9606.ENSP00000357731	0.517	Loricrin
19	9606.ENSP00000282356	0.510	Calcium/calmodulin-dependent protein kinase type IV
20	9606.ENSP00000296435	0.504	Cathelicidin antimicrobial peptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	1.000	endopeptidase activity
GO:0008236	1.000	serine-type peptidase activity
GO:0005515	0.976	protein binding
GO:0004252	0.938	serine-type endopeptidase activity
GO:0008237	0.322	metallopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.939	biological regulation
GO:0009987	0.930	cellular process
GO:0050789	0.920	regulation of biological process
GO:0032502	0.911	developmental process
GO:0048856	0.898	anatomical structure development
GO:0002702	0.824	positive regulation of production of molecular mediator of immune response
GO:0002786	0.813	regulation of antibacterial peptide production
GO:0002760	0.812	positive regulation of antimicrobial humoral response
GO:0009888	0.800	tissue development
GO:1900426	0.745	positive regulation of defense response to bacterium
GO:0008544	0.738	epidermis development
GO:0002225	0.710	positive regulation of antimicrobial peptide production
GO:0071704	0.659	organic substance metabolic process
GO:0044238	0.659	primary metabolic process
GO:0071840	0.605	cellular component organization or biogenesis
GO:0050794	0.599	regulation of cellular process
GO:0016043	0.584	cellular component organization
GO:1901564	0.557	organonitrogen compound metabolic process
GO:0019538	0.479	protein metabolic process
GO:0045229	0.377	external encapsulating structure organization
GO:0048522	0.337	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0012505	0.993	endomembrane system
GO:0043227	0.991	membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0031982	0.929	vesicle
GO:0071944	0.903	cell periphery
GO:0030141	0.903	secretory granule
GO:0016020	0.890	membrane
GO:0005615	0.848	extracellular space
GO:0005886	0.773	plasma membrane
GO:1903561	0.432	extracellular vesicle
GO:0001533	0.395	cornified envelope
GO:0070062	0.302	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.938	Serine endopeptidases.

[back to server]