StarFunc result for job id P49910

User Input

>input (485 residues)
MATEPKKAAAQNSPEDEGLLIVKIEEEEFIHGQDTCLQRSELLKQELCRQLFRQFCYQDS
PGPREALSRLRELCCQWLKPEIHTKEQILELLVLEQFLTILPGDLQAWVHEHYPESGEEA
VTILEDLERGTDEAVLQVQAHEHGQEIFQKKVSPPGPALNVKLQPVETKAHFDSSEPQLL
WDCDNESENSRSMPKLEIFEKIESQRIISGRISGYISEASGESQDICKSAGRVKRQWEKE
SGESQRLSSAQDEGFGKILTHKNTVRGEIISHDGCERRLNLNSNEFTHQKSCKHGTCDQS
FKWNSDFINHQIIYAGEKNHQYGKSFKSPKLAKHAAVFSGDKTHQCNECGKAFRHSSKLA
RHQRIHTGERCYECNECGKSFAESSDLTRHRRIHTGERPFGCKECGRAFNLNSHLIRHQR
IHTREKPYECSECGKTFRVSSHLIRHFRIHTGEKPYECSECGRAFSQSSNLSQHQRIHMR
ENLLM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49910	1.000	1.000	6.381E-77	485	1.000	1.000	P49910.pdb.gz	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
2	AFDB:Q8NF99	0.286	0.261	9.423E-36	534	0.458	0.416	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
3	AFDB:Q86W11	0.280	0.275	1.635E-34	494	0.447	0.439	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
4	AFDB:P10073	0.276	0.273	5.019E-33	491	0.377	0.373	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
5	AFDB:Q15776	0.290	0.245	7.923E-33	578	0.427	0.358	Q15776.pdb.gz	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	AFDB:Q9Y5A6	0.295	0.302	3.627E-31	473	0.402	0.412	Q9Y5A6.pdb.gz	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
7	AFDB:Q3ZBY5	0.290	0.301	4.557E-31	466	0.406	0.423	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
8	AFDB:Q96LW9	0.226	0.263	5.108E-31	406	0.398	0.475	Q96LW9.pdb.gz	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
9	AFDB:Q8CF60	0.210	0.156	5.726E-31	680	0.431	0.307	Q8CF60.pdb.gz	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
10	AFDB:O15535	0.282	0.345	9.570E-31	394	0.359	0.442	O15535.pdb.gz	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
11	PDB:3w5kB	0.102	0.279	4.825E-4	110	0.078	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6id0L	0.083	0.084	1.092E-1	475	0.113	0.116	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
13	PDB:7td5F	0.072	0.077	1.071	447	0.066	0.072	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
14	PDB:7dvqR	0.090	0.162	1.508	241	0.078	0.158	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:7td5A	0.073	0.072	1.596	497	0.085	0.082	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
16	PDB:7qo48	0.064	0.078	3.758	372	0.031	0.040	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
17	PDB:6ff4t	0.056	0.117	4.212	172	0.045	0.128	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:6iczL	0.079	0.082	4.212	454	0.109	0.117	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
19	PDB:5gm6a	0.036	0.107	4.459	123	0.023	0.089	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:5xbtA	0.055	0.086	4.459	271	0.043	0.077	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49910	0.0	1001	485	1.000	1.000	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
2	Q53Z40	0.0	1001	485	1.000	1.000	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
3	Q86W11	8.43e-125	374	494	0.478	0.470	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
4	Q8NF99	8.19e-123	370	534	0.478	0.434	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
5	Q15776	9.53e-113	346	578	0.470	0.394	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
6	Q3ZBY5	3.19e-108	331	466	0.402	0.418	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
7	O43309	4.03e-108	335	611	0.431	0.342	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
8	Q9Y5A6	7.78e-103	317	473	0.396	0.406	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
9	Q96LW9	9.24e-102	312	406	0.404	0.483	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
10	Q9BRR0	1.67e-101	316	538	0.429	0.387	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
11	P17029	2.25e-101	317	563	0.449	0.387	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
12	Q07231	6.60e-101	315	555	0.414	0.362	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
13	P10073	2.17e-100	311	491	0.406	0.401	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
14	A0A0S2Z658	4.36e-100	313	545	0.452	0.402	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
15	Q969J2	4.36e-100	313	545	0.452	0.402	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
16	Q16670	7.80e-96	300	478	0.388	0.393	ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2
17	A0A024RCN4	8.29e-96	299	479	0.390	0.395	A0A024RCN4_HUMAN Zinc finger and SCAN domain containing 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=1
18	I3L4J6	4.10e-95	296	435	0.379	0.423	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
19	Q9UNY5	7.97e-95	295	417	0.381	0.444	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
20	Q9P0L1	1.22e-90	294	754	0.421	0.271	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07754 HVO_2753_ZBP	4.1e+02	12.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
2	PF01155 HypA	5.8e+02	11.9	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
3	PF02023 SCAN	1.1e-38	142.2	SCAN domain
4	PF01286 XPA_N	0.044	25.1	XPA protein N-terminal
5	PF14149 YhfH	2.2e+02	13.2	YhfH-like protein
6	PF00096 zf-C2H2	2.1e-28	108.3	Zinc finger, C2H2 type
7	PF16622 zf-C2H2_11	1.1e-05	36.4	zinc-finger C2H2-type
8	PF18868 zf-C2H2_3rep	3.9e+02	13.1	Zinc finger C2H2-type, 3 repeats
9	PF13894 zf-C2H2_4	1e-12	58.7	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	8.6e-05	33.7	C2H2-type zinc finger
11	PF13465 zf-H2C2_2	4.9e-32	120.1	Zinc-finger double domain
12	PF13909 zf-H2C2_5	7.6e+02	11.3	C2H2-type zinc-finger domain
13	PF18439 zf_UBZ	0.18	22.8	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	38	16.5	zinc-ribbon family
15	PF13717 zinc_ribbon_4	5.5e+02	11.9	zinc-ribbon domain
16	PF09723 Zn-ribbon_8	0.73	21.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366542

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281722	0.775	Probable RNA-binding protein 46
2	9606.ENSP00000391788	0.739	Interactor of HORMAD1 protein 1
3	9606.ENSP00000472802	0.710	Zinc finger protein 446
4	9606.ENSP00000483936	0.707	Synaptotagmin-like protein 3
5	9606.ENSP00000276127	0.705	CPX chromosome region, candidate 1
6	9606.ENSP00000316377	0.656	Disks large-associated protein 1
7	9606.ENSP00000306776	0.644	Coiled-coil domain containing 110
8	9606.ENSP00000302144	0.624	Transmembrane protein 154
9	9606.ENSP00000276241	0.600	Cancer/testis antigen 55
10	9606.ENSP00000364555	0.594	Actin-like protein 8
11	9606.ENSP00000187762	0.592	Trimeric intracellular cation channel type A
12	9606.ENSP00000269053	0.572	Sperm acrosome membrane-associated protein 3
13	9606.ENSP00000484862	0.562	Disintegrin and metalloproteinase domain-containing protein 29
14	9606.ENSP00000409542	0.558	Coiled-coil domain-containing protein 188
15	9606.ENSP00000340088	0.528	Testicular haploid expressed gene protein
16	9606.ENSP00000351569	0.520	Small integral membrane protein 7
17	9606.ENSP00000312415	0.513	Synovial sarcoma, X breakpoint 5
18	9606.ENSP00000298181	0.512	Protein SSX7
19	9606.ENSP00000399356	0.504	Cancer/testis antigen 62
20	9606.ENSP00000232603	0.500	MORC family CW-type zinc finger protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.435	heterocyclic compound binding
GO:0097159	0.435	organic cyclic compound binding
GO:0003676	0.412	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.984	biological regulation
GO:0050794	0.956	regulation of cellular process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0051171	0.881	regulation of nitrogen compound metabolic process
GO:0080090	0.875	regulation of primary metabolic process
GO:0010468	0.847	regulation of gene expression
GO:0009889	0.845	regulation of biosynthetic process
GO:0031326	0.841	regulation of cellular biosynthetic process
GO:0010556	0.838	regulation of macromolecule biosynthetic process
GO:0006355	0.825	regulation of DNA-templated transcription
GO:0009987	0.555	cellular process
GO:0048519	0.545	negative regulation of biological process
GO:0048523	0.515	negative regulation of cellular process
GO:0051172	0.492	negative regulation of nitrogen compound metabolic process
GO:1902679	0.476	negative regulation of RNA biosynthetic process
GO:0045892	0.420	negative regulation of DNA-templated transcription
GO:0048518	0.315	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.987	intracellular organelle lumen
GO:0031981	0.984	nuclear lumen
GO:0005654	0.874	nucleoplasm
GO:0005737	0.709	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]