StarFunc result for job id P49914

User Input

>input (203 residues)
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQD
EIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVR
EEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQIC
LQVPVNENDMKVDEVLYEDSSTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49914	1.000	1.000	2.915E-45	203	1.000	1.000	P49914.pdb.gz	MTHFS_HUMAN 5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens OX=9606 GN=MTHFS PE=1 SV=2
2	PDB:3hy6A	0.969	0.994	1.177E-40	198	0.975	1.000	3hy6A.pdb.gz	Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
3	AFDB:Q9D110	0.991	0.991	1.881E-40	203	0.833	0.833	Q9D110.pdb.gz	MTHFS_MOUSE 5-formyltetrahydrofolate cyclo-ligase OS=Mus musculus OX=10090 GN=Mthfs PE=2 SV=2
4	AFDB:Q9P7W2	0.846	0.842	3.578E-18	204	0.256	0.255	Q9P7W2.pdb.gz	FTHC_SCHPO Probable 5-formyltetrahydrofolate cyclo-ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1703.08c PE=3 SV=1
5	AFDB:Q8L539	0.876	0.649	2.126E-17	277	0.300	0.220	Q8L539.pdb.gz	5FCL_ARATH 5-formyltetrahydrofolate cyclo-ligase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=5FCL PE=1 SV=1
6	AFDB:P0AC28	0.771	0.854	8.528E-16	182	0.222	0.247	P0AC28.pdb.gz	5FCL_ECOLI 5-formyltetrahydrofolate cyclo-ligase OS=Escherichia coli (strain K12) OX=83333 GN=ygfA PE=1 SV=1
7	AFDB:P40099	0.810	0.780	1.100E-15	211	0.281	0.270	P40099.pdb.gz	FTHC_YEAST 5-formyltetrahydrofolate cyclo-ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAU1 PE=1 SV=1
8	AFDB:Q2M296	0.597	0.346	9.540E-9	383	0.158	0.084	Q2M296.pdb.gz	MTHSD_HUMAN Methenyltetrahydrofolate synthase domain-containing protein OS=Homo sapiens OX=9606 GN=MTHFSD PE=1 SV=2
9	AFDB:Q9VN21	0.627	0.261	1.231E-8	545	0.187	0.070	Q9VN21.pdb.gz	Q9VN21_DROME LD30155p OS=Drosophila melanogaster OX=7227 GN=lost PE=1 SV=1
10	AFDB:Q9SRE0	0.590	0.365	1.858E-5	354	0.153	0.088	Q9SRE0.pdb.gz	5FCLL_ARATH 5-formyltetrahydrofolate cyclo-ligase-like protein COG0212 OS=Arabidopsis thaliana OX=3702 GN=COG0212 PE=2 SV=1
11	AFDB:P32144	0.368	0.301	3.221E-3	261	0.099	0.077	P32144.pdb.gz	CSQR_ECOLI HTH-type transcriptional repressor CsqR OS=Escherichia coli (strain K12) OX=83333 GN=csqR PE=1 SV=2
12	PDB:6i3mC	0.383	0.251	1.546E-2	342	0.094	0.056	6i3mC.pdb.gz	The structural basis of translational control by eIF2 phosphorylation.
13	PDB:6jlyG	0.389	0.241	2.125E-2	363	0.108	0.061	6jlyG.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
14	PDB:3ixqA	0.384	0.352	3.768E-2	225	0.084	0.076	3ixqA.pdb.gz
15	PDB:2ahuA	0.322	0.146	4.560E-2	515	0.074	0.029	2ahuA.pdb.gz
16	PDB:7l7gF	0.396	0.246	4.560E-2	357	0.079	0.045	7l7gF.pdb.gz	eIF2B conformation and assembly state regulates the integrated stress response.
17	PDB:5b04B	0.380	0.268	5.520E-2	319	0.113	0.072	5b04B.pdb.gz
18	PDB:3ecsC	0.378	0.281	7.120E-2	294	0.089	0.061	3ecsC.pdb.gz	Crystal structure of the alpha subunit of human translation initiation factor 2B
19	PDB:5knxB	0.323	0.360	9.185E-2	176	0.069	0.080	5knxB.pdb.gz	Crystal Structures of Acyclic Nucleoside Phosphonates in Complex with Escherichia coli Hypoxanthine Phosphoribosyltransferase
20	PDB:7kmaB	0.367	0.295	1.112E-1	268	0.099	0.075	7kmaB.pdb.gz	Sugar phosphate activation of the stress sensor eIF2B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49914	3.45e-152	421	203	1.000	1.000	MTHFS_HUMAN 5-formyltetrahydrofolate cyclo-ligase OS=Homo sapiens OX=9606 GN=MTHFS PE=1 SV=2
2	Q9D110	2.54e-128	361	203	0.833	0.833	MTHFS_MOUSE 5-formyltetrahydrofolate cyclo-ligase OS=Mus musculus OX=10090 GN=Mthfs PE=2 SV=2
3	P40099	4.19e-22	91.3	211	0.300	0.289	FTHC_YEAST 5-formyltetrahydrofolate cyclo-ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAU1 PE=1 SV=1
4	Q9P7W2	1.87e-18	81.6	204	0.286	0.284	FTHC_SCHPO Probable 5-formyltetrahydrofolate cyclo-ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1703.08c PE=3 SV=1
5	Q8L539	2.60e-15	74.3	277	0.305	0.224	5FCL_ARATH 5-formyltetrahydrofolate cyclo-ligase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=5FCL PE=1 SV=1
6	P0AC28	9.58e-15	71.2	182	0.227	0.253	5FCL_ECOLI 5-formyltetrahydrofolate cyclo-ligase OS=Escherichia coli (strain K12) OX=83333 GN=ygfA PE=1 SV=1
7	Q9CA78	0.40	33.9	798	0.256	0.065	NMAT4_ARATH Nuclear intron maturase 4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NMAT4 PE=3 SV=2
8	F6Y2X3	0.47	33.1	262	0.123	0.095	F6Y2X3_HUMAN Tafazzin family protein OS=Homo sapiens OX=9606 GN=TAFAZZIN PE=1 SV=1
9	Q8K370	0.98	32.7	1069	0.123	0.023	ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus OX=10090 GN=Acad10 PE=1 SV=1
10	Q9Z1D3	1.8	31.2	238	0.108	0.092	Q9Z1D3_RAT Mast cell protease 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mcpt3 PE=2 SV=1
11	E9PTQ9	2.3	31.2	246	0.108	0.089	E9PTQ9_RAT Mast cell protease 1-like 4 OS=Rattus norvegicus OX=10116 GN=Mcpt3 PE=4 SV=4
12	Q6JQN1	3.0	31.2	1059	0.108	0.021	ACD10_HUMAN Acyl-CoA dehydrogenase family member 10 OS=Homo sapiens OX=9606 GN=ACAD10 PE=1 SV=1
13	B0BF33	3.3	31.2	815	0.172	0.043	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
14	Q6FLP1	5.6	30.0	502	0.167	0.068	Q6FLP1_CANGA UTP--glucose-1-phosphate uridylyltransferase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=UGP1 PE=3 SV=1
15	P12000	6.2	30.0	768	0.113	0.030	DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc17 PE=3 SV=1
16	Q8K4J0	6.5	30.0	705	0.059	0.017	DCR1C_MOUSE Protein artemis OS=Mus musculus OX=10090 GN=Dclre1c PE=1 SV=2
17	A2RBC3	7.9	29.6	603	0.099	0.033	A2RBC3_ASPNC alpha-1,2-Mannosidase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An18g06220 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01812 5-FTHF_cyc-lig	3.1e-59	211.5	5-formyltetrahydrofolate cyclo-ligase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258874

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216605	0.973	C-1-tetrahydrofolate synthase, cytoplasmic
2	9606.ENSP00000377617	0.963	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
3	9606.ENSP00000379108	0.960	Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
4	9606.ENSP00000371253	0.954	Trifunctional purine biosynthetic protein adenosine-3
5	9606.ENSP00000291670	0.950	Formimidoyltransferase-cyclodeaminase
6	9606.ENSP00000455643	0.815	5-formyltetrahydrofolate cyclo-ligase
7	9606.ENSP00000318868	0.755	Serine hydroxymethyltransferase, cytosolic
8	9606.ENSP00000333667	0.742	Serine hydroxymethyltransferase, mitochondrial
9	9606.ENSP00000319531	0.733	Glycine cleavage system H protein, mitochondrial
10	9606.ENSP00000255189	0.728	Dimethylglycine dehydrogenase, mitochondrial
11	9606.ENSP00000360938	0.724	Sarcosine dehydrogenase, mitochondrial
12	9606.ENSP00000362344	0.717	Folylpolyglutamate synthase, mitochondrial
13	9606.ENSP00000361894	0.716	Glycine N-methyltransferase
14	9606.ENSP00000365777	0.707	Methylenetetrahydrofolate reductase
15	9606.ENSP00000236959	0.690	Bifunctional purine biosynthesis protein PURH
16	9606.ENSP00000354152	0.672	Methenyltetrahydrofolate synthase domain-containing protein
17	9606.ENSP00000439250	0.609	Peptidyl-prolyl cis-trans isomerase FKBP9
18	9606.ENSP00000478253	0.577	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
19	9606.ENSP00000315644	0.572	Thymidylate synthase
20	9606.ENSP00000419045	0.557	GTP cyclohydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030272	1.000	5-formyltetrahydrofolate cyclo-ligase activity
GO:0005542	1.000	folic acid binding
GO:0005524	1.000	ATP binding
GO:0005515	0.434	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043648	0.994	dicarboxylic acid metabolic process
GO:1901605	0.993	alpha-amino acid metabolic process
GO:0006575	0.987	cellular modified amino acid metabolic process
GO:0042558	0.986	pteridine-containing compound metabolic process
GO:1901575	0.982	organic substance catabolic process
GO:0043603	0.976	amide metabolic process
GO:0006766	0.976	vitamin metabolic process
GO:0046653	0.975	tetrahydrofolate metabolic process
GO:0046395	0.974	carboxylic acid catabolic process
GO:1901565	0.969	organonitrogen compound catabolic process
GO:0006767	0.968	water-soluble vitamin metabolic process
GO:0034641	0.962	cellular nitrogen compound metabolic process
GO:0009064	0.927	glutamine family amino acid metabolic process
GO:1901361	0.911	organic cyclic compound catabolic process
GO:0046700	0.911	heterocycle catabolic process
GO:0042219	0.907	cellular modified amino acid catabolic process
GO:0006536	0.901	glutamate metabolic process
GO:0043649	0.888	dicarboxylic acid catabolic process
GO:0044270	0.880	cellular nitrogen compound catabolic process
GO:0019439	0.871	aromatic compound catabolic process
GO:0035999	0.368	tetrahydrofolate interconversion
GO:0046655	0.346	folic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031974	0.996	membrane-enclosed lumen
GO:0070013	0.994	intracellular organelle lumen
GO:0005829	0.984	cytosol
GO:0005759	0.902	mitochondrial matrix
GO:0031981	0.410	nuclear lumen
GO:0005654	0.319	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10488	1.000	(6S)-5-formyl-5,6,7,8-tetrahydrofolate + ATP = (6R)-5,10-methenyltetrahydrofolate + ADP + phosphate
EC:6.3.3.2	1.000	5-formyltetrahydrofolate cyclo-ligase.

[back to server]