StarFunc result for job id P49915

User Input

>input (693 residues)
MALCNGDSKLENAGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETP
AFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHK
KSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANE
SKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSKVL
VLLSGGVDSTVCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
HSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMNLKPE
EVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR
ILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPH
TLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDW
ESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILR
ESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVE
VVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2vxoB	0.795	0.833	0.000	658	0.949	1.000	2vxoB.pdb.gz	Substrate Specificity and Oligomerization of Human Gmp Synthetase
2	AFDB:A0A140VJK6	0.948	0.948	0.000	693	1.000	1.000	A0A140VJK6.pdb.gz	A0A140VJK6_HUMAN GMP synthase (glutamine-hydrolyzing) OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:Q8WSN4	0.921	0.887	2.135E-94	720	0.573	0.551	Q8WSN4.pdb.gz	Q8WSN4_DROME GMP synthase (glutamine-hydrolyzing) OS=Drosophila melanogaster OX=7227 GN=bur PE=2 SV=1
4	AFDB:P32073	0.889	0.859	1.665E-84	718	0.488	0.471	P32073.pdb.gz	GUAA_DICDI GMP synthase [glutamine-hydrolyzing] OS=Dictyostelium discoideum OX=44689 GN=guaA PE=1 SV=2
5	AFDB:Q57V01	0.848	0.890	1.215E-79	658	0.456	0.480	Q57V01.pdb.gz	Q57V01_TRYB2 GMP synthase (glutamine-hydrolyzing) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.550 PE=4 SV=1
6	AFDB:P9WMS7	0.678	0.885	1.436E-47	525	0.296	0.390	P9WMS7.pdb.gz	GUAA_MYCTU GMP synthase [glutamine-hydrolyzing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaA PE=1 SV=1
7	AFDB:Q5APF2	0.603	0.776	2.347E-47	530	0.332	0.434	Q5APF2.pdb.gz	GUAA_CANAL GMP synthase [glutamine-hydrolyzing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GUA1 PE=3 SV=1
8	AFDB:P04079	0.619	0.808	1.026E-46	525	0.290	0.383	P04079.pdb.gz	GUAA_ECOLI GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain K12) OX=83333 GN=guaA PE=1 SV=1
9	AFDB:P38625	0.603	0.784	1.588E-46	525	0.315	0.415	P38625.pdb.gz	GUAA_YEAST GMP synthase [glutamine-hydrolyzing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUA1 PE=1 SV=4
10	AFDB:Q8IJR9	0.565	0.689	3.985E-45	555	0.271	0.339	Q8IJR9.pdb.gz	GUAA_PLAF7 GMP synthase [glutamine-hydrolyzing] OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=GMPS PE=1 SV=1
11	AFDB:Q9CAD1	0.595	0.760	4.446E-45	534	0.281	0.365	Q9CAD1.pdb.gz	Q9CAD1_ARATH GMP synthase [glutamine-hydrolyzing] OS=Arabidopsis thaliana OX=3702 GN=At1g63660 PE=1 SV=1
12	PDB:1gpmA	0.598	0.818	5.623E-42	501	0.278	0.385	1gpmA.pdb.gz	The crystal structure of GMP synthetase reveals a novel catalytic triad and is a structural paradigm for two enzyme families.
13	PDB:4wioA	0.489	0.621	6.167E-40	525	0.248	0.328	4wioA.pdb.gz	Active site coupling in Plasmodium falciparum GMP synthetase is triggered by domain rotation.
14	PDB:3uowB	0.560	0.782	2.231E-36	477	0.237	0.344	3uowB.pdb.gz	Crystal Structure of PF10_0123, a GMP Synthetase from Plasmodium Falciparum
15	PDB:4wimB	0.534	0.737	1.580E-21	480	0.235	0.340	4wimB.pdb.gz
16	PDB:1i7qB	0.244	0.831	1.253E-13	192	0.068	0.245	1i7qB.pdb.gz	The structures of anthranilate synthase of Serratia marcescens crystallized in the presence of (i) its substrates, chorismate and glutamine, and a product, glutamate, and (ii) its end-product inhibitor, L-tryptophan.
17	PDB:7d50B	0.233	0.582	1.606E-10	255	0.079	0.216	7d50B.pdb.gz	Structure and mechanism of the gamma-glutamyl-gamma-aminobutyrate hydrolase SpuA from Pseudomonas aeruginosa.
18	PDB:5douD	0.212	0.108	3.093E-10	1430	0.108	0.052	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
19	PDB:6uelA	0.209	0.113	3.848E-10	1333	0.078	0.041	6uelA.pdb.gz	Small Molecule Inhibition of CPS1 Activity through an Allosteric Pocket.
20	PDB:6w2jB	0.209	0.111	4.533E-10	1364	0.094	0.048	6w2jB.pdb.gz	Discovery of 2,6-Dimethylpiperazines as Allosteric Inhibitors of CPS1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJK6	0.0	1424	693	1.000	1.000	A0A140VJK6_HUMAN GMP synthase (glutamine-hydrolyzing) OS=Homo sapiens OX=9606 PE=2 SV=1
2	P32073	0.0	642	718	0.495	0.478	GUAA_DICDI GMP synthase [glutamine-hydrolyzing] OS=Dictyostelium discoideum OX=44689 GN=guaA PE=1 SV=2
3	P49915	0.0	1424	693	1.000	1.000	GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1
4	Q3THK7	0.0	1404	693	0.980	0.980	GUAA_MOUSE GMP synthase [glutamine-hydrolyzing] OS=Mus musculus OX=10090 GN=Gmps PE=1 SV=2
5	Q4V7C6	0.0	1400	693	0.980	0.980	GUAA_RAT GMP synthase [glutamine-hydrolyzing] OS=Rattus norvegicus OX=10116 GN=Gmps PE=1 SV=1
6	Q57V01	0.0	568	658	0.468	0.492	Q57V01_TRYB2 GMP synthase (glutamine-hydrolyzing) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.43M14.550 PE=4 SV=1
7	Q8WSN4	0.0	795	720	0.579	0.557	Q8WSN4_DROME GMP synthase (glutamine-hydrolyzing) OS=Drosophila melanogaster OX=7227 GN=bur PE=2 SV=1
8	Q9VIE7	0.0	822	683	0.579	0.587	Q9VIE7_DROME GMP synthase (glutamine-hydrolyzing) OS=Drosophila melanogaster OX=7227 GN=bur PE=1 SV=3
9	Q5APF2	8.07e-100	318	530	0.306	0.400	GUAA_CANAL GMP synthase [glutamine-hydrolyzing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GUA1 PE=3 SV=1
10	P38625	1.23e-94	304	525	0.294	0.389	GUAA_YEAST GMP synthase [glutamine-hydrolyzing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUA1 PE=1 SV=4
11	P04079	2.59e-92	298	525	0.300	0.396	GUAA_ECOLI GMP synthase [glutamine-hydrolyzing] OS=Escherichia coli (strain K12) OX=83333 GN=guaA PE=1 SV=1
12	Q9P772	3.30e-88	288	539	0.299	0.384	GUAA_SCHPO GMP synthase [glutamine-hydrolyzing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gua1 PE=3 SV=1
13	P9WMS7	1.93e-86	283	525	0.277	0.366	GUAA_MYCTU GMP synthase [glutamine-hydrolyzing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=guaA PE=1 SV=1
14	Q9CAD1	5.79e-79	263	534	0.270	0.350	Q9CAD1_ARATH GMP synthase [glutamine-hydrolyzing] OS=Arabidopsis thaliana OX=3702 GN=At1g63660 PE=1 SV=1
15	Q8IJR9	1.78e-74	252	555	0.260	0.324	GUAA_PLAF7 GMP synthase [glutamine-hydrolyzing] OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=GMPS PE=1 SV=1
16	P00903	4.28e-10	61.6	187	0.059	0.219	PABA_ECOLI Aminodeoxychorismate synthase component 2 OS=Escherichia coli (strain K12) OX=83333 GN=pabA PE=1 SV=1
17	P00937	6.91e-09	61.2	484	0.066	0.095	TRPG_YEAST Multifunctional tryptophan biosynthesis protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRP3 PE=1 SV=2
18	Q42565	4.22e-08	57.4	276	0.072	0.181	ASB1_ARATH Anthranilate synthase beta subunit 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASB1 PE=1 SV=1
19	F4IAW5	2.01e-07	55.5	289	0.063	0.152	F4IAW5_ARATH Anthranilate synthase beta subunit 1 OS=Arabidopsis thaliana OX=3702 GN=ASB1 PE=1 SV=1
20	Q9FXK1	3.16e-07	54.3	235	0.063	0.187	Q9FXK1_ARATH F5A9.17 OS=Arabidopsis thaliana OX=3702 GN=At1g24807 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00764 Arginosuc_synth	6	17.7	Arginosuccinate synthase
2	PF00733 Asn_synthase	0.85	20.8	Asparagine synthase
3	PF01171 ATP_bind_3	0.75	21.0	PP-loop family
4	PF00117 GATase	2.4e-36	136.8	Glutamine amidotransferase class-I
5	PF00958 GMP_synt_C	4.2e-14	63.7	GMP synthase C terminal domain
6	PF02540 NAD_synthase	4.6e-09	47.3	NAD synthase
7	PF01507 PAPS_reduct	3.8	19.0	Phosphoadenosine phosphosulfate reductase family
8	PF07722 Peptidase_C26	9.6e-09	46.9	Peptidase C26
9	PF07992 Pyr_redox_2	3.5e+02	11.8	Pyridine nucleotide-disulphide oxidoreductase
10	PF06508 QueC	4.7e-05	34.5	Queuosine biosynthesis protein QueC
11	PF02568 ThiI	4.6	18.3	Thiamine biosynthesis protein (ThiI)
12	PF03054 tRNA_Me_trans	0.036	25.2	tRNA methyl transferase HUP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419851

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343535	0.999	Ubiquitin carboxyl-terminal hydrolase 7
2	9606.ENSP00000345096	0.997	Inosine-5'-monophosphate dehydrogenase 1
3	9606.ENSP00000321584	0.994	Inosine-5'-monophosphate dehydrogenase 2
4	9606.ENSP00000259727	0.993	GMP reductase 1
5	9606.ENSP00000367615	0.988	Adenine phosphoribosyltransferase
6	9606.ENSP00000361704	0.987	CTP synthase 1
7	9606.ENSP00000298556	0.973	Hypoxanthine-guanine phosphoribosyltransferase
8	9606.ENSP00000313490	0.969	Phosphoribosylformylglycinamidine synthase
9	9606.ENSP00000355890	0.961	Bifunctional glutamate/proline--tRNA ligase
10	9606.ENSP00000369456	0.958	Inosine triphosphate pyrophosphatase
11	9606.ENSP00000355689	0.953	Guanylate kinase
12	9606.ENSP00000312304	0.948	Thiopurine S-methyltransferase
13	9606.ENSP00000371253	0.948	Trifunctional purine biosynthetic protein adenosine-3
14	9606.ENSP00000382595	0.940	Multifunctional protein ADE2
15	9606.ENSP00000401264	0.937	CTP synthase 2
16	9606.ENSP00000485525	0.934	Adenylosuccinate lyase
17	9606.ENSP00000339479	0.927	Cytosolic purine 5'-nucleotidase
18	9606.ENSP00000331901	0.925	Elongation factor 1-gamma
19	9606.ENSP00000257770	0.923	5'-nucleotidase
20	9606.ENSP00000484415	0.919	Cytosolic 5'-nucleotidase 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003922	1.000	GMP synthase (glutamine-hydrolyzing) activity
GO:0005488	0.831	binding
GO:0005515	0.706	protein binding
GO:0003921	0.514	GMP synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0006139	0.992	nucleobase-containing compound metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:1901576	0.979	organic substance biosynthetic process
GO:0044249	0.979	cellular biosynthetic process
GO:0019693	0.977	ribose phosphate metabolic process
GO:0072521	0.977	purine-containing compound metabolic process
GO:0009117	0.977	nucleotide metabolic process
GO:0009126	0.975	purine nucleoside monophosphate metabolic process
GO:1901293	0.972	nucleoside phosphate biosynthetic process
GO:0009161	0.936	ribonucleoside monophosphate metabolic process
GO:0009150	0.935	purine ribonucleotide metabolic process
GO:0009167	0.927	purine ribonucleoside monophosphate metabolic process
GO:1901566	0.926	organonitrogen compound biosynthetic process
GO:0009127	0.918	purine nucleoside monophosphate biosynthetic process
GO:0009156	0.917	ribonucleoside monophosphate biosynthetic process
GO:0009260	0.915	ribonucleotide biosynthetic process
GO:0006164	0.915	purine nucleotide biosynthetic process
GO:0046037	0.912	GMP metabolic process
GO:0009168	0.898	purine ribonucleoside monophosphate biosynthetic process
GO:0009152	0.893	purine ribonucleotide biosynthetic process
GO:0006177	0.351	GMP biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005829	0.992	cytosol
GO:0031981	0.512	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11680	1.000	ATP + H2O + L-glutamine + XMP = AMP + diphosphate + GMP + 2 H(+) + L-glutamate
EC:6.3.5.2	1.000	GMP synthase (glutamine-hydrolyzing).
RHEA:18301	0.514	ATP + NH4(+) + XMP = AMP + diphosphate + GMP + 2 H(+)

[back to server]