StarFunc result for job id P49916

User Input

>input (1009 residues)
MSLAFKIFFPQTLRALSRKELCLFRKHHWRDVRQFSQWSETDLLHGHPLFLRRKPVLSFQ
GSHLRSRATYLVFLPGLHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIG
KVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQITQH
IADLSSKAAGTPKKKAVVQAKLTTTGQVTSPVKGASFVTSTNPRKFSGFSAKPNNSGEAP
SSPTPKRSLSSSKCDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFH
GDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQ
SKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDL
KMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQEVEKEPGQRRALSVQASLMTP
VQPMLAEACKSVEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAH
FKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIYF
NDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKRVTKALDLADMITRVIQEGLEGLVLK
DVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPGS
QKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKVNKIYYPDFIVPDPKKAA
VWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFTV
VAGDEGSSTTGGSSEENKGPSGSAVSRKAPSKPSASTKKAEGKLSNSNSKDGNMQTAKPS
AMKVGEKLATKSSPVKVGEKRKAADETLCQTKVLLDIFTGVRLYLPPSTPDFSRLRRYFV
AFDGDLVQEFDMTSATHVLGSRDKNPAAQQVSPEWIWACIRKRRLVAPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A096MKE9	0.690	0.695	0.000	1002	0.886	0.892	A0A096MKE9.pdb.gz	A0A096MKE9_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=2
2	AFDB:F1QJL4	0.633	0.632	0.000	1011	0.657	0.656	F1QJL4.pdb.gz	F1QJL4_DANRE DNA ligase OS=Danio rerio OX=7955 GN=im:7139055 PE=1 SV=2
3	AFDB:P49916	1.000	1.000	0.000	1009	1.000	1.000	P49916.pdb.gz	DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2
4	AFDB:P97386	0.618	0.614	0.000	1015	0.883	0.878	P97386.pdb.gz	DNLI3_MOUSE DNA ligase 3 OS=Mus musculus OX=10090 GN=Lig3 PE=1 SV=2
5	AFDB:Q5ZLW6	0.693	0.772	0.000	902	0.711	0.795	Q5ZLW6.pdb.gz	Q5ZLW6_CHICK DNA ligase OS=Gallus gallus OX=9031 GN=RCJMB04_4j11 PE=2 SV=1
6	AFDB:A0A024RE06	0.521	0.574	1.713E-47	911	0.171	0.190	A0A024RE06.pdb.gz
7	AFDB:Q90YB1	0.525	0.578	1.713E-47	912	0.179	0.198	Q90YB1.pdb.gz	DNLI4_CHICK DNA ligase 4 OS=Gallus gallus OX=9031 GN=LIG4 PE=2 SV=2
8	AFDB:D4A0U6	0.523	0.577	1.153E-46	911	0.172	0.191	D4A0U6.pdb.gz	D4A0U6_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig4 PE=3 SV=1
9	AFDB:A7E283	0.512	0.567	1.503E-46	909	0.156	0.173	A7E283.pdb.gz	A7E283_DANRE DNA ligase OS=Danio rerio OX=7955 GN=lig4 PE=1 SV=1
10	AFDB:Q9JHY8	0.504	0.552	6.494E-43	918	0.188	0.207	Q9JHY8.pdb.gz	DNLI1_RAT DNA ligase 1 OS=Rattus norvegicus OX=10116 GN=Lig1 PE=1 SV=1
11	PDB:7lsyY	0.512	0.600	1.508E-41	855	0.167	0.198	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
12	PDB:6dt1A	0.332	0.673	1.851E-19	464	0.083	0.181	6dt1A.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
13	PDB:4pz6A	0.172	0.404	3.856E-10	373	0.066	0.180	4pz6A.pdb.gz	How an mRNA capping enzyme reads distinct RNA polymerase II and Spt5 CTD phosphorylation codes.
14	PDB:3kyhC	0.164	0.383	8.330E-9	387	0.056	0.145	3kyhC.pdb.gz
15	PDB:6rieO	0.147	0.176	2.750E-7	822	0.045	0.055	6rieO.pdb.gz	Structural Basis of Poxvirus Transcription: Transcribing and Capping Vaccinia Complexes.
16	PDB:2owoA	0.216	0.350	2.414E-6	586	0.051	0.087	2owoA.pdb.gz	Last Stop on the Road to Repair: Structure of E. coli DNA Ligase Bound to Nicked DNA-Adenylate.
17	PDB:3nc0E	0.141	0.419	5.634E-6	294	0.030	0.102	3nc0E.pdb.gz	NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
18	PDB:2c5uA	0.111	0.252	1.721E-3	375	0.028	0.075	2c5uA.pdb.gz	Molecular Architecture and Ligand Recognition Determinants for T4 RNA Ligase
19	PDB:7ohpn	0.063	0.187	1.018E-1	314	0.017	0.054	7ohpn.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
20	PDB:7p5zG	0.054	0.213	1.639E-1	213	0.014	0.066	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKE9	0.0	1789	961	0.866	0.909	A0A096MKE9_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=2
2	A0A0G2JV76	0.0	1854	1015	0.893	0.888	A0A0G2JV76_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=1
3	F1QJL4	0.0	1319	1011	0.643	0.642	F1QJL4_DANRE DNA ligase OS=Danio rerio OX=7955 GN=im:7139055 PE=1 SV=2
4	F7FP17	0.0	1711	956	0.828	0.873	F7FP17_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=1
5	K7ERZ5	0.0	1118	545	0.531	0.983	K7ERZ5_HUMAN DNA ligase 3 (Fragment) OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=1
6	P49916	0.0	2098	1009	1.000	1.000	DNLI3_HUMAN DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2
7	P97386	0.0	1808	1015	0.884	0.879	DNLI3_MOUSE DNA ligase 3 OS=Mus musculus OX=10090 GN=Lig3 PE=1 SV=2
8	Q5U2M4	0.0	1694	943	0.822	0.879	Q5U2M4_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=1
9	Q5ZLW6	0.0	1484	902	0.713	0.797	Q5ZLW6_CHICK DNA ligase OS=Gallus gallus OX=9031 GN=RCJMB04_4j11 PE=2 SV=1
10	K7EQB6	2.32e-126	383	185	0.183	1.000	K7EQB6_HUMAN DNA ligase 3 (Fragment) OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=1
11	P12000	1.21e-53	203	768	0.162	0.212	DNLI1_SCHPO DNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc17 PE=3 SV=1
12	Q587E4	2.52e-48	186	699	0.128	0.185	Q587E4_TRYB2 DNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.80 PE=3 SV=1
13	F5GZ28	6.43e-48	187	851	0.123	0.146	F5GZ28_HUMAN DNA ligase OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1
14	P18858	6.74e-48	187	919	0.123	0.135	DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1
15	P37913	3.80e-46	182	916	0.122	0.134	DNLI1_MOUSE DNA ligase 1 OS=Mus musculus OX=10090 GN=Lig1 PE=1 SV=2
16	Q42572	8.84e-46	179	790	0.126	0.161	DNLI1_ARATH DNA ligase 1 OS=Arabidopsis thaliana OX=3702 GN=LIG1 PE=2 SV=2
17	P04819	6.85e-45	176	755	0.146	0.195	DNLI1_YEAST DNA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC9 PE=1 SV=2
18	Q8IES4	6.88e-45	177	912	0.123	0.136	Q8IES4_PLAF7 DNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1304100 PE=3 SV=1
19	Q9JHY8	2.21e-43	173	918	0.118	0.130	DNLI1_RAT DNA ligase 1 OS=Rattus norvegicus OX=10116 GN=Lig1 PE=1 SV=1
20	Q9W1H4	6.37e-43	170	747	0.119	0.161	DNLI1_DROME DNA ligase 1 OS=Drosophila melanogaster OX=7227 GN=DNAlig1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16589 BRCT_2	0.0079	27.9	BRCT domain, a BRCA1 C-terminus domain
2	PF04679 DNA_ligase_A_C	1.8e-15	68.6	ATP dependent DNA ligase C terminal region
3	PF01068 DNA_ligase_A_M	2.8e-58	208.5	ATP dependent DNA ligase domain
4	PF04675 DNA_ligase_A_N	8.7e-32	122.3	DNA ligase N terminus
5	PF16759 LIG3_BRCT	3.8e-23	92.9	DNA ligase 3 BRCT domain
6	PF01331 mRNA_cap_enzyme	1.3e+02	13.9	mRNA capping enzyme, catalytic domain
7	PF09414 RNA_ligase	0.04	25.7	RNA ligase
8	PF15191 Synaptonemal_3	48	15.3	Synaptonemal complex central element protein 3
9	PF00645 zf-PARP	7.8e-22	89.1	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262887	0.999	DNA repair protein XRCC1
2	9606.ENSP00000265421	0.996	DNA polymerase beta
3	9606.ENSP00000337353	0.993	Tyrosyl-DNA phosphodiesterase 1
4	9606.ENSP00000323511	0.985	Bifunctional polynucleotide phosphatase/kinase
5	9606.ENSP00000322570	0.977	DNA polymerase epsilon catalytic subunit A
6	9606.ENSP00000406046	0.972	DNA polymerase delta catalytic subunit
7	9606.ENSP00000368458	0.968	Proliferating cell nuclear antigen
8	9606.ENSP00000305480	0.966	Flap endonuclease 1
9	9606.ENSP00000352257	0.965	X-ray repair cross-complementing protein 6
10	9606.ENSP00000254719	0.961	Replication protein A 70 kDa DNA-binding subunit
11	9606.ENSP00000363017	0.951	Replication protein A 32 kDa subunit
12	9606.ENSP00000347170	0.943	Endonuclease 8-like 1
13	9606.ENSP00000055077	0.938	Replication factor C subunit 2
14	9606.ENSP00000371321	0.936	Replication factor C subunit 1
15	9606.ENSP00000376272	0.936	Replication factor C subunit 4
16	9606.ENSP00000216367	0.931	DNA polymerase epsilon subunit 2
17	9606.ENSP00000480186	0.930	DNA polymerase delta subunit 2
18	9606.ENSP00000369411	0.929	Replication factor C subunit 3
19	9606.ENSP00000408295	0.927	Replication factor C subunit 5
20	9606.ENSP00000263681	0.926	DNA polymerase delta subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003909	1.000	DNA ligase activity
GO:0005488	0.986	binding
GO:0005515	0.973	protein binding
GO:0003910	0.411	DNA ligase (ATP) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0050896	0.995	response to stimulus
GO:0044238	0.995	primary metabolic process
GO:0006281	0.987	DNA repair
GO:0006284	0.942	base-excision repair
GO:0050789	0.841	regulation of biological process
GO:0050794	0.753	regulation of cellular process
GO:0006302	0.593	double-strand break repair
GO:0051052	0.536	regulation of DNA metabolic process
GO:0071840	0.520	cellular component organization or biogenesis
GO:0016043	0.492	cellular component organization
GO:0006996	0.449	organelle organization
GO:0048519	0.343	negative regulation of biological process
GO:0048523	0.318	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.985	intracellular organelle lumen
GO:0005654	0.982	nucleoplasm
GO:0032991	0.907	protein-containing complex
GO:0043232	0.879	intracellular non-membrane-bounded organelle
GO:0005694	0.776	chromosome
GO:0005737	0.637	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.5.-.-	1.000	Forming phosphoric ester bonds.
EC:6.5.1.1	0.411	DNA ligase (ATP).

[back to server]